(data stored in ACNUC7421 zone)

EMBL: BA000012.MSR0529

BA000012.MSR0529     Location/Qualifiers
FT   CDS_pept        391082..391339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0529"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48096"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48096"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ML7"
FT                   /protein_id="BAB48096.1"
FT                   /translation="MSRFLVATSVAVFLAAGPALAADDKPLPPPNAKKLSEILAKVEQR
FT                   DGFRYVKEVDWDNGAYTVTYYTSDKAKVEITYDPVTAEPK"
     atgtccagat ttctcgtggc aaccagcgtc gccgtttttc tcgctgccgg acccgctctg        60
     gctgcggatg acaagccgct gccgccgccc aacgccaaga agctgtcgga gatcctcgcc       120
     aaggtcgagc agcgcgatgg ctttcgctat gtgaaagagg tcgactggga caatggcgcc       180
     tataccgtca cctactacac gtcggacaag gcgaaggtcg aaatcaccta cgatccagtg       240
     acggccgagc ctaagtaa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page