(data stored in ACNUC7421 zone)

EMBL: BA000012.MSR0731

BA000012.MSR0731     Location/Qualifiers
FT   CDS_pept        574801..574953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0731"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48263"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48263"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M50"
FT                   /protein_id="BAB48263.1"
FT                   /translation="MLIYMLATAMTVAMLIATVFGLHQEAQRIRVKATTKRFEGFGPRE
FT                   PYRHY"
     atgctgatct acatgctcgc caccgcaatg acagtcgcca tgctgatcgc caccgtattc        60
     gggctgcatc aggaggcaca acgcatccgc gtcaaggcaa ccaccaagcg cttcgaaggc       120
     ttcggccccc gcgagccgta tcgtcactac taa                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page