(data stored in ACNUC7421 zone)

EMBL: BA000012.MSR0960

BA000012.MSR0960     Location/Qualifiers
FT   CDS_pept        780697..780948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0960"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48434"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48434"
FT                   /db_xref="GOA:Q98LM9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LM9"
FT                   /protein_id="BAB48434.1"
FT                   /translation="MRPVVKTLGTLRHKSLITMLIAKREASGLTQTELAEKLGEYQSFV
FT                   ARLESGQRRVDVVEFIDLAKILGFDPSSAIKRLAAEPD"
     atgaggccgg tggtgaaaac gctcggaacg ctgcgccaca agtcattgat cacgatgctg        60
     attgcaaagc gtgaggctag cgggctgaca cagaccgagc tcgccgaaaa gctcggcgaa       120
     tatcagtcgt ttgtcgctcg actcgaaagc ggccaacgcc gcgtcgacgt agtcgaattc       180
     atcgatctgg cgaaaatcct ggggttcgac ccttcttcag ccatcaagag attggcagca       240
     gaaccagact ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page