(data stored in ACNUC7421 zone)

EMBL: BA000030.FABC4

BA000030.FABC4       Location/Qualifiers
FT   CDS_pept        255013..255273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabC4"
FT                   /locus_tag="SAVERM_217"
FT                   /old_locus_tag="SAV_217"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_217"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67926"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RC6"
FT                   /protein_id="BAC67926.1"
FT                   /translation="MDDITSVVIDFLAEYEGVSPGELRSELEQDGRELPVDSLLVVEIL
FT                   TRIEERYHVAIPADREAAQATGSVRAFAAAVLDAIEERQQS"
     atggacgaca tcacctcggt cgtcatcgac ttcctcgccg agtacgaggg cgtctccccc        60
     ggcgagcttc gctccgaact ggagcaggac gggcgggagt tgcccgtgga ctccctcttg       120
     gtggtcgaga tcctcacgcg catcgaggag cgttaccacg tcgccattcc cgcagaccgg       180
     gaagcggccc aggcgaccgg gtcggtgcgg gcattcgccg cggcggtcct ggacgcgatc       240
     gaagaaaggc agcagtcatg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page