(data stored in ACNUC7421 zone)

EMBL: BA000030.FECC1

BA000030.FECC1       Location/Qualifiers
FT   CDS_pept        complement(751402..752148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecC1"
FT                   /locus_tag="SAVERM_600"
FT                   /old_locus_tag="SAV_600"
FT                   /product="putative ABC transporter iron(III)/siderophore
FT                   transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_600"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68310"
FT                   /db_xref="GOA:Q79ZS4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q79ZS4"
FT                   /protein_id="BAC68310.1"
FT                   /translation="MQLEAAKGDIVGLVGPNGSGKSTLLRTVYRSLRPADGVVRVGGDD
FT                   VWELSARTAARRTAAVLQDAGTTTGLTVTEIVALGRTPHHGLMGRDGAEDREAVTEAVE
FT                   RCGVGPFADRDYATLSGGERQRVLLARALAQRPQLLVLDELTNHLDIRARFELLDLIRS
FT                   TGITTLAVLHDLDLAARLCDHLVVLHEGAVVAAGPVLEVLTPDLLREVFGVRGATERHA
FT                   DGVVRITYAAEPLALDREAEPAPAER"
     gtgcagctgg aggccgccaa gggcgacatc gtcggactcg tgggccccaa cggcagcggc        60
     aagtccaccc tgctccgtac ggtctaccgc tcgctgcgcc cggccgacgg cgtggtcagg       120
     gtcggcggcg acgacgtatg ggagctgtct gctcgtaccg ccgcccgccg cacggcggcc       180
     gttctccagg acgccggcac cacgaccggc ctgaccgtaa ccgagatcgt cgccctggga       240
     cgtacgcccc atcacggcct gatgggtcgg gacggcgccg aggaccgcga ggccgtgacc       300
     gaggcggtcg aacgctgcgg agtcggcccc ttcgcggacc gggactacgc caccctgtcc       360
     ggcggcgaac gccagcgcgt cctgctggcc cgtgccctcg cccagcgtcc gcagcttctg       420
     gtcctggacg aactcaccaa ccacctcgac atccgcgccc ggttcgaact cctggacctg       480
     atccgcagca ccggcatcac caccctggcg gtcctgcacg acctcgacct cgccgcccga       540
     ctctgcgacc acctcgtcgt gctccacgaa ggcgcggtgg tcgcggcggg acccgtgctg       600
     gaggtcctga caccggacct cctgcgagag gtcttcggcg tacggggcgc cacggagcgg       660
     catgccgacg gcgtcgtccg catcacctat gccgccgagc cgctcgccct ggaccgggag       720
     gccgagcccg cgcccgcaga gcggtga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page