(data stored in ACNUC7421 zone)

EMBL: BA000030.FECD1

BA000030.FECD1       Location/Qualifiers
FT   CDS_pept        complement(752205..753176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecD1"
FT                   /locus_tag="SAVERM_601"
FT                   /old_locus_tag="SAV_601"
FT                   /product="putative ABC transporter iron(III)/siderophore
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_601"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68311"
FT                   /db_xref="GOA:Q79ZS3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q79ZS3"
FT                   /protein_id="BAC68311.1"
FT                   /translation="MVAVSIGAVNIPVADVWGILLHHVTGRGAAGDPALDQIVWTFRAP
FT                   RVALAALVGAGLAVAGAVLQTLVSNPLADPVVLGFSYGASLGAVLVITLGGVALGGLAG
FT                   LGVSGAAFVGALAAGALVFALGQRQGRLAPTRLVLAGVAVGYVLLSVTSFVQLLATPTE
FT                   LRTVMFWMLGSVAGAQWSQLPTVTAVVLTSTVVLTLFGRRLNALLAGDESATALGVDVN
FT                   RLRAVLLVISALLTGTVIAVAGGVGFVGLMIPHLVRLTTGADHRRLLPLTALLGAVYLV
FT                   LVDLLSRTVNRPNELPLGILTALLGAPFFLWLLRRDKGLDTV"
     gtggtggcgg tgagtatcgg agcggtgaac atcccggtgg cggatgtgtg gggcattctc        60
     ctgcaccacg tcaccgggcg gggagccgcc ggtgacccgg cgctggacca gatcgtgtgg       120
     accttccggg ctcctcgcgt cgccctggcc gccctggtcg gcgcgggact ggccgtcgcc       180
     ggagcggtgc tccagaccct ggtctccaac ccgctcgccg acccggtcgt cctcggcttc       240
     tcctacggcg cctcgctcgg cgccgtgctg gtcatcaccc tcggcggcgt cgcactcggc       300
     gggctggccg gtctcggcgt gtcgggcgcg gcattcgtcg gcgcactggc cgccggggca       360
     ctggtcttcg ccctggggca acgtcagggc cggctggccc ccacccggct ggtcctggcg       420
     ggggtcgcgg tcggctatgt cctgctgtcc gtgacgagct tcgtccaact gctggcgacg       480
     cccaccgagc tgcggaccgt gatgttctgg atgctcggca gcgtcgccgg cgcccagtgg       540
     agccaactgc ccaccgtcac ggcggtggtc ctgacgagca ccgtcgtgct gaccctgttc       600
     ggccgccgcc tcaacgccct gctggccggt gacgagtccg ccaccgcgct cggggtggac       660
     gtcaaccggc tgcgcgccgt cctcctggtg atcagcgcgc tgctcaccgg caccgtcatc       720
     gccgtagcgg gtggcgtcgg cttcgtcggc ctgatgatcc cccacctggt ccgcctcacc       780
     accggagcgg accaccgcag actgctgccc ctgaccgcac tcctgggcgc cgtgtacctc       840
     gtcctcgtcg acctgctctc ccgcaccgtc aaccgcccca acgaactgcc gctgggcatc       900
     ctcaccgctc tgctcggcgc ccccttcttc ctgtggctgc tgcgccgcga caagggcctg       960
     gacaccgtat ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page