(data stored in ACNUC7421 zone)

EMBL: BA000030.GVPA1

BA000030.GVPA1       Location/Qualifiers
FT   CDS_pept        complement(749920..750369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpA1"
FT                   /locus_tag="SAVERM_598"
FT                   /old_locus_tag="SAV_598"
FT                   /product="putative gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_598"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68308"
FT                   /db_xref="GOA:Q82QB2"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QB2"
FT                   /protein_id="BAC68308.1"
FT                   /translation="MTVVPQSGGGGVAQGGGSGTLYDVLELVLDRGLVIDVFARVSLVG
FT                   IEILKIDARVVVASVDTYLRFAEACNRLDLESGRKAPAQLTDLVGEVTEGGAKGKSKGA
FT                   LTGAVEAVTESFHQGHEEDREEEREPAAERKRPRPTRRPARRREE"
     atgactgtgg tgccgcaaag cggtggaggc ggcgtcgccc agggcggcgg ctcgggaacg        60
     ctgtacgacg tcctggaact ggtcctggat cgcgggctcg tcatcgacgt cttcgcccgc       120
     gtttcgctgg tgggcatcga gatcctgaag atcgacgccc gtgtggtggt ggccagcgtc       180
     gatacctacc tgcgcttcgc cgaggcctgc aacaggctcg atctggagag cgggcgcaaa       240
     gccccggcac agctgaccga cctcgtcgga gaggtcaccg aaggcggagc caagggaaag       300
     agcaagggcg ccctcaccgg cgcggtggag gccgtcacgg agtcgttcca ccaggggcat       360
     gaggaggacc gagaggaaga gcgcgagccg gcagcggagc ggaagaggcc acggccgacg       420
     cgccgccctg ctcggcgccg ggaagagtga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page