(data stored in ACNUC7421 zone)

EMBL: BA000030.GVPF1

BA000030.GVPF1       Location/Qualifiers
FT   CDS_pept        complement(749194..749916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpF1"
FT                   /locus_tag="SAVERM_597"
FT                   /old_locus_tag="SAV_597"
FT                   /product="putative gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_597"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68307"
FT                   /db_xref="GOA:Q82QB3"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QB3"
FT                   /protein_id="BAC68307.1"
FT                   /translation="MAVYVYAITAASHPLRLDGVTGVGEPPEKLRTVNSRSLAAVVSDA
FT                   PDGLRAKRRDVLAHEAVLERLMAEGSVLPLRFGAVTSDDQAVLQVLDERAASYQERLTA
FT                   LDGCVEFHLKASCDEDALLREILLQSPEAHQLNEQIRSGRAGPDLQIALGERVAGEVQL
FT                   RHESFAAGAVEALRPLARDIRASDPKGGDFVSVSFLVDKARQEGFTAAEQDLANERGAD
FT                   FDFRLHGPLPPYSFVEAT"
     atggccgtct atgtctacgc catcacagcc gcgagccacc ccctacgcct ggacggcgtc        60
     accggcgtgg gagaaccgcc ggagaagctg cgcaccgtga acagtcggtc gctggcagcg       120
     gtggtcagcg atgcgccgga cgggctcaga gccaagcggc gcgacgtcct ggcgcatgag       180
     gcggtgctgg aacggctgat ggccgagggc agtgtgctgc ccctgcgttt cggagcggtg       240
     acctccgacg atcaagcggt gctccaggtg ctggatgagc gagccgcctc gtatcaggag       300
     cggctgacgg ccctggacgg ctgtgtggag ttccacctga aggcatcctg cgacgaggac       360
     gcgctgctgc gggagatcct gctgcaatca cccgaggccc accagctgaa cgagcagatc       420
     cgcagcggcc gggccggccc ggatctgcag atcgcgctgg gcgaacgggt agctggggag       480
     gtccagttgc gccacgagtc ctttgccgcg ggagccgtcg aagcgctgcg tcccctggca       540
     cgcgacatcc gggcttcgga tccgaaaggc ggtgacttcg tgagcgtctc gttccttgtg       600
     gacaaggccc ggcaggaggg cttcacggcc gcggagcagg atctggcgaa cgagcgcgga       660
     gcggacttcg acttccgtct gcacgggccg ctgccgccct acagcttcgt cgaggcaacg       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page