(data stored in ACNUC7421 zone)

EMBL: BA000030.GVPJ1

BA000030.GVPJ1       Location/Qualifiers
FT   CDS_pept        complement(748258..748707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpJ1"
FT                   /locus_tag="SAVERM_594"
FT                   /old_locus_tag="SAV_594"
FT                   /product="putative gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_594"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68304"
FT                   /db_xref="GOA:Q82QB6"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QB6"
FT                   /protein_id="BAC68304.1"
FT                   /translation="MTEPVPSNLGSFPSRASPSYGQGSSANLADILERVLDKGIVIAGD
FT                   IQINLLDIELLTIKLRLLVASVDKAKEMGIDWWEHDPALSSHADGGRELAEENRRLREE
FT                   IAGLRDAQALPSAEGPAEKPERPKKRASTAKSTRAGNRRTPRTER"
     gtgaccgaac ctgtcccgag caacctcggc tccttcccct cccgggcgtc cccgtcctac        60
     ggccagggct cctcggccaa cctggccgac atcctggaac gcgtactgga caagggcatc       120
     gtcatcgcgg gtgacattca gatcaacctc ctcgacatcg aactgctcac catcaagctg       180
     cgtctcctcg tggcctcggt cgacaaggcc aaggaaatgg gcatcgactg gtgggaacac       240
     gacccggccc tgtcctccca cgctgacggc ggccgtgagc tggccgagga gaaccgaaga       300
     ctgcgtgaag agatagctgg cctgcgcgac gcccaggccc ttccgtcggc cgagggcccc       360
     gctgagaaac ccgagcgtcc caagaagcgt gccagtacgg ccaagtccac ccgcgccggc       420
     aaccggcgga caccgaggac agagcgatga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page