(data stored in ACNUC7421 zone)

EMBL: BA000030.GVPO1

BA000030.GVPO1       Location/Qualifiers
FT   CDS_pept        complement(750480..750848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpO1"
FT                   /locus_tag="SAVERM_599"
FT                   /old_locus_tag="SAV_599"
FT                   /product="putative gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_599"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68309"
FT                   /db_xref="GOA:Q82QB1"
FT                   /db_xref="InterPro:IPR008634"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QB1"
FT                   /protein_id="BAC68309.1"
FT                   /translation="MPADRNGDSARPRKRTHRGTEESRVRSRGESPRPSQRLSASRAML
FT                   SAMQQLKELLGKAPESVSAVRPTDDGWEAEVEVLEIERIPETTSVMASYRVTLDADGEL
FT                   MAYERIRRYTRAQVDRRA"
     atgcctgcgg atcgaaacgg cgatagcgcg aggccccgta agcgcacgca tcgcgggacc        60
     gaggagtctc gcgtccgcag ccgaggtgag agcccgcgcc cctcgcagcg gctttcagcg       120
     tcgcgagcca tgctctcggc gatgcagcag ctgaaggagc tgctgggaaa ggcgccggaa       180
     tccgtctcag cggttcggcc caccgatgac ggatgggaag ccgaggtgga ggtgctggag       240
     atcgagcgca tacctgagac gaccagcgtg atggccagct accgggtgac gctcgacgcg       300
     gatggcgagc tgatggcgta cgagcggatc cgccggtaca cacgcgccca ggtcgaccgg       360
     cgtgcctga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page