(data stored in ACNUC7421 zone)

EMBL: BA000030.MCJA1

BA000030.MCJA1       Location/Qualifiers
FT   CDS_pept        complement(303121..303240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcjA1"
FT                   /locus_tag="SAVERM_7584"
FT                   /product="putative microcin mature peptide"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_7584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A146F5C7"
FT                   /protein_id="BAU68359.1"
FT                   /translation="MTAETSYETPILTEIGDFADVTRATYRGFWVDFLGGWWF"
     atgaccgcag agacctcgta cgagacgccc atactcactg agatcggtga cttcgccgac        60
     gtcacccgcg ccacctaccg cggcttctgg gtggatttcc tcggcggctg gtggttctga       120
//

If you have problems or comments...

PBIL Back to PBIL home page