(data stored in ACNUC7421 zone)

EMBL: BA000030.NRPS6

BA000030.NRPS6       Location/Qualifiers
FT   CDS_pept        complement(754376..758698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrps6"
FT                   /locus_tag="SAVERM_603"
FT                   /old_locus_tag="SAV_603"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_603"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68313"
FT                   /db_xref="GOA:Q79ZS1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q79ZS1"
FT                   /protein_id="BAC68313.1"
FT                   /translation="MDDTARRHPLLAAQEGIWTGQQLDPDSPAYNTAEYVLIEGPVDTA
FT                   VFDAALHHVVAETEALNVVFVVDDQGRPWQATAPVGDWRLHTADLTTEPNPHAAALAWM
FT                   GEDMARPVDLARGPVFGHALLRTAPEQYLWYHRVHHIALDGFGLSLVARRVAQVYTALA
FT                   AGERAAAGGFGTLASVRDEERAYRESPRFAKARAYWADRFADRPPVATPAGRTALPART
FT                   FHRRVADLDAAQTQALRAVARDLQLTWSEVLLAVTVAQLHHATRAPEIVLSLPAMGRLG
FT                   SVSLRVPCMVRNILPLRVAVTASDSLRDLAARISRELRAGLPHQRYRYEQLRRDLKLVG
FT                   GQRRLSGPGVNIMPFEYDLRFAGHRSTVHNISAGPVDDLSVNVYDRSEGAGLRIAVDAN
FT                   PDLYDEADVAALQEGLLALLEEAVAAPDRALGDLCAREPVPVLDGGPLPGPVRPVLGLI
FT                   ADHAARHGGFVAVEHGGTSITYARLFGSARALARRLAARQVGHGDLVAVALPRGIDAIT
FT                   AILGVLLSGAAYSPLDPTAPRARRAELLDDARPDLVLTTSAFADRFGDRAVLRHDEPGP
FT                   DSEAAQSTAPTPEDLAYVLHTSGSTGRPKGVEVGHHALAHFVAGATHRYGLHHRDRVLQ
FT                   FAPLHFDTSLEEIFLTLCAGATLVVRTDDMTESVPGFLDACARLRISFLDLPTAYWHEL
FT                   AYAVSTGAVTLPAEVRTVVIGGEAALPERVERWRTAVGTSVRLLNTYGPTEATVVATVA
FT                   DLHDPSLAPGDVPIGLPLPGTRAAVVDGELHLLGDNLAIGYRGDRPPDTSRFAPLDQIP
FT                   GAPRAYRTGDLVRIGDDGQLRYLGRSDTEFKISGHRVHPAEVEGALLGHPRVRDAVVVG
FT                   LVLGDGTRRLVAYVVPDGPAPAVALIRDHLRETLPAAMIPSAVEFLDRLPRTSSGKIDR
FT                   NALAATTPDGHVPEPGAQAATSDSALVRTIAAVWQQVLGVAAVFARDDVFDLGAHSLQA
FT                   IQVANRLGVELHRDLKVAWLFQHPTPAELARFLEQQEQPRSAPPGLPAALLADTVLDPD
FT                   IRPGDGPRASGTPDRILLTGATGFVGAHLLAELLTSTGAEAVCTVRAASPAEATARIHQ
FT                   ALETHLIHLPDAARERITAVPADLARPRLGVDEALFADLARTCGAIIHNAATVSIMREY
FT                   ATLRAANTESTRDLLRMAAVRSIPLHLVSTLSVAPPLDLAPEVPEAFLAAHPGLRHGYQ
FT                   QSKWAAERLLEQAAERGLPVTVHRLGRIVGPRTTGYVNERDFLWSVLRAGIPARIVPDL
FT                   FDEETWTPVDHVAQALVHLCLGQRPPGATVFNHATARPVRLADVYDWLEDYGYPLRRMP
FT                   LAQWRAELPRSSGDSGVAATMLAFFDAWEANPDDATGPELRLGRVRADNVVNGLHGSGI
FT                   TSPPVDRDLVFRYLDHCVTTGTLPAPAGKQSHLATPAK"
     atggatgaca cagcgcggcg tcatccgttg ctggccgctc aggaaggcat ctggaccggc        60
     cagcagctcg acccggacag tcccgcgtac aacacggccg agtacgtgct catcgaagga       120
     ccggtggaca cggccgtctt cgatgcggcc ctgcaccacg tggtcgccga gacggaggcc       180
     ctgaacgtcg tcttcgtcgt cgacgaccag ggccgcccct ggcaggcaac cgccccggtc       240
     ggcgactggc gcctgcacac ggccgacctc accaccgagc ccaatccgca cgcggcggcc       300
     ctggcctgga tgggcgagga catggcccgc cccgtcgacc tcgcgcgcgg ccccgtcttc       360
     ggccacgccc tgctgcgcac cgcgccggag cagtacctct ggtaccaccg cgtgcaccac       420
     atcgccctcg acggcttcgg cctgtcgctg gtcgcccgcc gagtcgccca ggtctacacg       480
     gccctggcgg cgggcgagcg ggcggcggcc ggcggcttcg gcacgctggc ctcggtgcgg       540
     gacgaggaac gcgcctaccg ggagtcgccc cgcttcgcca aggcccgcgc ctactgggcg       600
     gaccggttcg cggaccggcc gcccgtggcc actcccgccg gccgtacggc cctgcccgcg       660
     cgcacgttcc accggcgagt ggcggacctc gacgcggcgc agacgcaggc cctgcgtgcc       720
     gttgcccggg acctccaact cacctggtcc gaggtgctgt tggccgtgac cgtggcccag       780
     ctgcaccacg cgacccgtgc accggagatc gtcctcagcc tgccggcgat gggacgtctg       840
     ggctctgtgt ccctgcgcgt tccctgcatg gtgcgcaaca tcctgcccct gcgcgtcgcc       900
     gtcaccgcct cggacagcct gcgcgacctc gcggcccgca tctcccgcga gctgcgcgcc       960
     gggctgccgc accagcgcta ccgctacgaa cagctgcggc gcgacctcaa gctcgtcggc      1020
     ggacagcgcc ggctctccgg tcctggcgtc aacatcatgc ccttcgagta cgacctgcgc      1080
     ttcgccggac accggagcac ggtccacaat atctccgcgg gccccgtcga cgacctgtcc      1140
     gtcaacgtct acgaccgttc cgagggcgcg ggactgcgca tcgccgtgga cgccaacccc      1200
     gacctctacg acgaggcgga cgtcgccgca ctccaggagg ggctgctagc cctgctcgag      1260
     gaggccgtcg cggcccctga ccgggcgctc ggcgacctgt gtgcgcgcga gcccgtcccg      1320
     gtcctggacg gtgggccgct gcccggcccc gtgcgcccgg ttctcggcct gatcgccgac      1380
     catgccgccc ggcatggcgg attcgtcgcc gtcgagcacg gcggcaccag catcacgtat      1440
     gcccgactct tcggatcggc gcgtgcactc gcgcgccgac tggctgcccg tcaggtcggc      1500
     cacggcgacc tggtggccgt cgccctgccg cgcggtatcg acgcgatcac cgccatcctc      1560
     ggagtcctgc tgtccggtgc cgcctacagc ccgctcgacc cgacggcgcc ccgggcccgc      1620
     agggcggaac tgctggacga cgcccggccc gacctcgtcc tcaccaccag cgccttcgcc      1680
     gaccgcttcg gggaccgggc cgttctgcga cacgacgagc cgggaccaga ttccgaagcg      1740
     gcccagtcga cggcaccgac gcccgaggac ctcgcctacg tcctccacac ctcgggctcc      1800
     acggggcgcc ccaagggcgt cgaagtcggc caccacgccc tcgcgcactt cgtcgccggc      1860
     gccacgcacc gctacggcct tcaccaccgg gaccgcgtcc tgcagttcgc ccccctgcac      1920
     ttcgacacca gcctcgagga aatcttcctc acactgtgtg cgggcgccac gctcgtcgtc      1980
     cgtaccgacg acatgaccga gtcggtcccc ggattcctgg acgcctgcgc acggctgcgg      2040
     atcagcttcc tcgacctgcc tacggcctac tggcacgaac tggcgtacgc cgtttcgacc      2100
     ggtgcggtca ctctgccggc cgaggtgcgc accgtcgtca tcggcggtga ggcggccctc      2160
     cccgagcggg tcgaacgctg gcgcacggcc gtcggcacgt cggtccggct gctgaacacc      2220
     tatgggccga ccgaggccac cgtggtcgcc accgtcgccg acctccacga cccctcgctc      2280
     gctccgggag acgtcccgat cggactgccg ctgcctggca cccgagccgc ggtcgtcgac      2340
     ggcgaactcc acctcctggg cgacaacctg gccatcggct accgcggaga ccggccaccg      2400
     gacacctccc gcttcgcccc tctggaccag atccccggag cgccccgcgc ctaccgcaca      2460
     ggcgacctgg tacggatcgg cgacgacggg cagctgcgct acctgggccg gtcggacacc      2520
     gagttcaaga tcagcggaca tcgagtgcac ccggccgaag tcgagggcgc cctccttggc      2580
     catccgcgag tccgtgacgc ggttgtcgta gggctggtgc tgggcgacgg gacgcggcgc      2640
     ctggtcgcgt acgtcgtccc ggacgggccc gccccggccg tggccctgat cagggaccac      2700
     ctccgggaga cgctgcccgc ggccatgatc ccgtcggccg tcgagttcct tgaccgcctg      2760
     ccccggacga gctcagggaa gatcgacagg aacgcgctcg ccgcgacgac ccccgacgga      2820
     catgtgccgg agcccggtgc gcaggccgcg acgtccgaca gtgcactggt gcgcaccatc      2880
     gccgccgtct ggcaacaggt gctcggcgtg gccgccgtct ttgcccggga cgatgtgttc      2940
     gacctggggg cccactcgct ccaggccatc caggtcgcca accgcctcgg cgtcgaactg      3000
     caccgtgacc tcaaagtcgc ctggctcttc cagcacccga ccccggccga actggcgaga      3060
     ttcctggaac agcaggagca gcctcgctcg gcccctcccg gccttccggc ggccctgctc      3120
     gccgacaccg tcctcgatcc ggacatccgc cccggcgacg gtccccgggc gagcggcacg      3180
     ccggacagaa tcctgctcac cggagccacc ggcttcgtcg gcgcacatct gctggccgaa      3240
     ctcctgacga gcaccggcgc ggaggccgtc tgcaccgtgc gcgccgctag ccccgccgag      3300
     gccaccgccc gcatccacca ggccctggaa acccacctga tccacctccc ggacgcggcg      3360
     cgcgaacgca tcacagcggt ccccgccgac ctcgcccgcc cccgcctcgg cgtggacgag      3420
     gcactcttcg ccgacctcgc ccggacctgc ggggcgatca tccacaacgc ggcgaccgtc      3480
     agcatcatgc gcgaatacgc caccctccgc gccgccaaca ccgagtccac ccgggacctg      3540
     ctgcgcatgg cggctgtgcg ctccattccc ctgcacttgg tgtcgaccct ctccgtcgcc      3600
     ccgcccctcg acctcgcccc ggaggtaccg gaggcgttcc ttgcggccca ccccggactg      3660
     cgccacggct accagcagtc gaagtgggcg gccgagcgcc tgctggaaca ggccgccgaa      3720
     agaggcctgc cggtcaccgt gcaccggctc ggccggatcg tcggcccacg caccactggc      3780
     tacgtgaacg aacgggactt cctctggagc gtgctgcgcg cggggatccc cgcgcgcatc      3840
     gtccccgacc tgttcgacga ggagacatgg acacccgtcg accacgtcgc ccaggccctc      3900
     gtccacctct gcctcggaca gcgcccgccg ggagcgacgg ttttcaacca cgccaccgcc      3960
     cgcccggtgc ggctggccga cgtctacgac tggctggagg actacggcta tccgctgcgg      4020
     cgcatgccgc tggcccagtg gcgtgccgaa ctgccgcgat cctccggtga ctccggcgtg      4080
     gcggcgacca tgctcgcctt cttcgacgcc tgggaggcga accccgacga cgcgaccggg      4140
     ccggagctac gcctgggacg cgtccgtgcc gacaacgtcg tgaacggcct gcacggcagc      4200
     ggcatcacct ccccgcccgt cgaccgtgac ctcgtcttcc gttacctcga ccactgcgtc      4260
     accaccggaa cgctgcccgc cccggccggg aagcagagcc atctcgcaac cccggcaaag      4320
     tag                                                                    4323
//

If you have problems or comments...

PBIL Back to PBIL home page