(data stored in ACNUC7421 zone)

EMBL: BA000030.PE1

BA000030.PE1         Location/Qualifiers
FT   CDS_pept        complement(1380..1811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1"
FT                   /old_locus_tag="SAV_1"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67710"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RZ1"
FT                   /protein_id="BAC67710.1"
FT                   /translation="MTAEWYVLVEEDTRETKRADGVELRLHRWKLAATQHIAGDQEQAA
FT                   AAAEDAALNYMPGVLARHARPGDEPARHAFLTQDGAWLVLLRQRHRECHIRVTTARLMH
FT                   TQEEKEAPPKSFKEKLRSALDGPQPPEPAGRPWKPGSET"
     atgaccgccg agtggtacgt cctcgtcgaa gaggacacac gagagaccaa gcgcgccgac        60
     ggcgttgaac tcagattgca ccgctggaaa ctggcggcca ctcagcacat cgcaggagat       120
     caggaacagg ccgccgccgc ggccgaggat gcggccctga actacatgcc gggagtgctc       180
     gctcggcatg cccgaccggg agacgaaccg gcccggcatg ctttcctcac ccaggacggg       240
     gcctggctgg tgctcctcag gcagcggcac cgcgagtgtc acatacgggt gaccactgcc       300
     cggctcatgc atacacagga agagaaggag gccccgccga aaagcttcaa ggagaaactc       360
     cgcagcgccc tggatggtcc tcagccgccc gaaccggctg gtaggccatg gaagccgggc       420
     agcgaaacct ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page