(data stored in ACNUC7421 zone)

EMBL: BA000030.PE102

BA000030.PE102       Location/Qualifiers
FT   CDS_pept        complement(118868..119221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_102"
FT                   /old_locus_tag="SAV_102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_102"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67811"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RP1"
FT                   /protein_id="BAC67811.1"
FT                   /translation="MTSRHGTTTLWRPTGPKELDLVRELKWRAWPARLLGQPFFYPVLN
FT                   EDYAVKIARDWNVKHDGAGFVTRFEVESQFLRRYPVRQAGGQTILELWVPAAELDDFNA
FT                   HMAGEIEVVHEFR"
     atgaccagcc ggcacggaac gacgaccctg tggcgcccca ccggccccaa ggagctggac        60
     ctggtccggg aactgaagtg gcgggcgtgg cccgcgcggc ttttggggca gccgttcttc       120
     tacccggtcc tcaacgagga ctacgcggtc aagatcgcgc gggactggaa cgtgaagcac       180
     gacggtgccg gcttcgtcac ccggttcgag gtcgagtcgc agttcctgcg ccggtatccc       240
     gtccggcagg ccggcgggca gacgattctc gaactgtggg ttccggccgc agagctcgac       300
     gacttcaacg cccacatggc cggggagatc gaggtggtcc acgagttccg ctga             354
//

If you have problems or comments...

PBIL Back to PBIL home page