(data stored in ACNUC7421 zone)

EMBL: BA000030.PE106

BA000030.PE106       Location/Qualifiers
FT   CDS_pept        123637..124200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_106"
FT                   /old_locus_tag="SAV_106"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_106"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67815"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RN7"
FT                   /protein_id="BAC67815.1"
FT                   /translation="MFSKRLIAAAATAVVIAGLGACGSETGNGSGSGGADLGSSWSDDA
FT                   GRSGQDAAPHARPDTDTVRGLRDSVRHLSRKTAKATRPHLVNKCTPATRRAKHTQQRGT
FT                   GTRKKTRTWYTTEHYQDCKKVRNGTETYTRTVRPQQWCVRLDDVDGDTSQDDRWYQVTR
FT                   TTYDEALTMAEHTRIEFTPAGTGC"
     atgttcagca agcgactgat agcggccgca gcgaccgcgg tggtgatagc cgggctgggc        60
     gcatgcggca gcgaaaccgg gaacgggagc gggagcggcg gcgcggacct ggggtcctcc       120
     tggagcgacg acgccggccg gagcggccag gacgccgccc cgcacgcccg gccggacacg       180
     gacaccgtgc ggggactgcg ggactcggtc cgccacctct ccaggaaaac cgccaaggcc       240
     acccgcccgc acctggtcaa caagtgcacg cctgccaccc ggcgggccaa gcacacccag       300
     cagaggggaa cgggcacccg gaagaagacc cgcacctggt acaccacgga gcactaccag       360
     gactgcaaga aggtccgcaa cggcaccgag acctacacac gaaccgtcag gccgcaacag       420
     tggtgcgtgc gcctggacga cgtcgacggc gacacctccc aggacgaccg ctggtaccag       480
     gtcacccgga ccacctacga cgaagccctc accatggccg agcacacccg catcgagttc       540
     accccggccg gcaccggctg ctga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page