(data stored in ACNUC7421 zone)

EMBL: BA000030.PE107

BA000030.PE107       Location/Qualifiers
FT   CDS_pept        124557..124883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_107"
FT                   /old_locus_tag="SAV_107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_107"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67816"
FT                   /db_xref="GOA:Q82RN6"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RN6"
FT                   /protein_id="BAC67816.1"
FT                   /translation="MQLDVYGYVVETLYLAHQSGVARCGDTAVLHQRLVEHLAERWQMP
FT                   DEGIWEVRGERRHFVHSKVMAWAVVDRTIRLVEAGALDAGLCALMELREAIRHEVCTRG
FT                   FEPV"
     ttgcagctcg acgtgtacgg ctacgtggtc gagaccctgt acctcgccca ccaaagcggt        60
     gtggcccgct gcggcgacac cgcggtcctg caccagcggc tggtcgagca ccttgccgag       120
     cggtggcaga tgcccgacga gggcatctgg gaagtccgag gtgagcgccg ccacttcgtg       180
     cactccaagg tcatggcctg ggccgtggtc gaccggacca tccgcctggt cgaggccggc       240
     gccctggacg ccggcctgtg cgctctgatg gaactgcgcg aggccatccg ccacgaggtg       300
     tgcacccgcg gcttcgagcc ggtttga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page