(data stored in ACNUC7421 zone)

EMBL: BA000030.PE108

BA000030.PE108       Location/Qualifiers
FT   CDS_pept        124945..125364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_108"
FT                   /old_locus_tag="SAV_108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_108"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67817"
FT                   /db_xref="GOA:Q82RN5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RN5"
FT                   /protein_id="BAC67817.1"
FT                   /translation="MGFLSPGGPRVLGTVEAVRRQPATLEGFVRRYPTAGDHAGLDGLD
FT                   GDEGGLPALLVVDGRRARSDRPPGQAHGLFGRFLALRTDLGLLAEEYDHVTGWQLGNFP
FT                   QAYSHIGVIGSALLLQQLGSGAPAAEAEVLLAADV"
     gtgggattcc tgtcccccgg cggcccccgc gtgctgggga cggtggaggc ggtgcgccgg        60
     cagccggcca ctttggaggg attcgtacgg cgctacccga ccgcaggaga tcacgcgggg       120
     ctcgacggcc tggacggtga cgaggggggc cttcctgctc tgctcgttgt ggatggtcga       180
     cgcgctcgct ctgaccggcc gcccggccaa gcccacggtc tcttcggccg gttcctggcc       240
     ctgcgcaccg acctcggcct gctcgccgag gagtacgacc acgtcaccgg atggcagttg       300
     ggaaacttcc cgcaggcgta cagccacatc ggggtgatcg ggtccgcgct cctgctgcag       360
     cagctcggct cgggggcgcc cgcagccgag gccgaagtgc tcctggcggc ggatgtctga       420
//

If you have problems or comments...

PBIL Back to PBIL home page