(data stored in ACNUC7421 zone)

EMBL: BA000030.PE112

BA000030.PE112       Location/Qualifiers
FT   CDS_pept        129497..132031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_112"
FT                   /old_locus_tag="SAV_112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_112"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67821"
FT                   /db_xref="GOA:Q82RN1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RN1"
FT                   /protein_id="BAC67821.1"
FT                   /translation="MERLPTPAGQQADIPDASPAPACTATATISEQGIVTGWSEGAREL
FT                   LGYTPPQIVGHPAARLLADGTGEQARRETAGRERFSGQVALLHRDGHRLLRNLLAHRRT
FT                   PQGPQPAEWLVVSAVTAASASPRTPDSQALREWVFSQSPCILAVFDTDLRLVTANTGME
FT                   SALLLPEEQMRGLRLPEITPGPASEEAETKMRRALETGQTQHMQAYLHPTGVSAQRGWS
FT                   TTLAPLKDPGGTVRAVCLAAHHRQQEHLARQRMLLLNDAGARIGTTSDIQRTVQELADV
FT                   AVPRLADFAAVDLLDVPRRGGEPARLPATGPITMHRTALHTTPDNHTSHTSHTSHDGDD
FT                   GDGGDTHPATPPAAGEKILYPAQSPVAQCLAQGHGALYEADDPALTRWAANDPTAAWTR
FT                   RQGTHSVMVVPLRAHGTTLGVALFARSHRPEPFEADDLWLAEELTAQTAVHLHNAHRHA
FT                   REHTTTMTLQRSLLPQKLPDQGALDIATRYLPAGSKAGVGGDWFDVIPLSGARVALVVG
FT                   DVVGHGIRASATMGRVRTAVRTLADVDLPPDELLTYLDDLVIHLAADEGGGAEGTTETA
FT                   AGIGTTCLYAVYDPTTRHCTIARAGHPPPAVVTPDGNVRFLNVPAGPPLGLGGLPFETL
FT                   ETQLPEAASSPSTPTDSSKPATTTSTKASTKCSTPSPAPPTTSTPSATESSPPCSPTAP
FT                   TTTSPSSSPAPAPSTPTKSPPSTSPPTPPSSPKHANTPPPNSPPGTSPTPPSPPNSSSA
FT                   NSSPTPSATATHPSNSASSTTTTPSPPKSPTPATPPPTCAAPAPTTKEDAASSSSANSP
FT                   NAGAPATPPPAKPSGPNKPSPPTNTEFRFRWV"
     atggagcgac ttcccacccc tgccggccag caggcggaca taccggacgc ctcccccgca        60
     ccggcctgca cggccaccgc caccatcagt gagcagggca tcgtgacggg gtggagcgaa       120
     ggcgcccgcg aactgctggg ctacacgccc ccgcagatcg tgggacatcc cgccgcacgc       180
     ctgctcgccg acggcacggg cgaacaggca cggcgcgaga cagccgggcg cgagcggttc       240
     agcggccagg tggcactcct gcaccgcgac ggccaccggc tgctgcgcaa cctcctcgcg       300
     caccgccgca caccgcaagg accgcagccg gccgagtggc tcgtggtgtc cgcggtgacc       360
     gcggcctccg caagtccccg cacccccgac agccaggccc tgcgggaatg ggtgttcagc       420
     cagtccccct gcatcctggc cgtcttcgac acagacctgc ggctggtcac cgccaacacc       480
     ggcatggaaa gtgcgctgct gctccccgag gaacagatgc gcgggctgcg cctgccggag       540
     atcacacccg gccccgcaag cgaagaagcc gaaacaaaaa tgcgccgcgc actggaaacc       600
     ggccagacac agcacatgca ggcctacctc caccccaccg gggtgagcgc acagcgcggc       660
     tggtcgacca cactggcccc gctgaaagac cccggcggaa cggtgcgcgc cgtatgcctg       720
     gcagcccacc accgccagca agaacacctg gcccggcagc ggatgctgct gctcaacgat       780
     gccggagccc gcatcggcac cacctccgac atccagcgca ccgtgcagga actggccgac       840
     gtcgccgttc cccggctcgc cgacttcgcc gccgtcgacc tgctggacgt cccccggcgc       900
     ggcggcgaac ccgcccgcct ccccgccacc ggccccatca ccatgcaccg caccgccctg       960
     cacaccaccc ccgacaacca caccagccac accagccaca ccagccacga cggcgacgac      1020
     ggcgacggcg gcgacacgca ccccgccacc ccgcccgcag ccggcgagaa aatcctctac      1080
     ccggcacagt caccggtggc ccagtgcctg gcccagggcc acggcgccct gtacgaagca      1140
     gacgaccccg cactcacccg ctgggcagcc aacgacccca cagccgcctg gacccgccgg      1200
     cagggaaccc actcggtgat ggtggtaccc ctgcgcgccc acggcaccac cctcggcgtc      1260
     gccctcttcg cccgcagcca ccgccccgaa cccttcgaag cagacgacct gtggctcgcc      1320
     gaagaactca ccgcccagac cgccgtccac ctccacaacg cccaccgcca cgcccgcgaa      1380
     cacaccacca ccatgaccct gcagcgcagc ctgctccccc agaaactgcc cgaccaggga      1440
     gcactcgaca tcgccacccg ctacctgccc gccggcagca aagccggcgt cggcggcgac      1500
     tggttcgacg tcatccccct ctccggcgcc cgcgtcgccc tcgtcgtcgg cgacgtcgtc      1560
     ggccacggca tccgcgcctc cgccaccatg ggccgcgtcc gcaccgccgt acgcaccctc      1620
     gccgacgtcg acctgccccc cgacgaactc ctcacctacc tcgacgacct cgtcatccac      1680
     ctcgccgccg acgaaggcgg cggcgccgaa ggcaccaccg aaaccgccgc aggcatcggc      1740
     accacctgcc tctacgccgt ctacgacccc acaacccgcc actgcaccat cgcccgcgcc      1800
     ggccaccccc cacccgccgt cgtcaccccc gacggcaacg tccgcttcct caacgtcccc      1860
     gccggccccc cactgggcct gggcggcctc cccttcgaaa ccctcgaaac ccaactcccc      1920
     gaagcagcct cctcaccctc tacaccgacg gactcctcga aacccgcgac cacgacatcg      1980
     acgaaggcct cgacaaaatg ttccacgccc tcgcccgccc cgcccacaac ctcgacaccg      2040
     tctgcgacag aatcctcacc accatgctca cccaccgccc cgacgacgac atcgccctcc      2100
     tcatcgcccg cacccgcgcc ctcaacacca accaaatcgc caccttcaac ctcccctccc      2160
     accccgccat cgtcgcccaa gcacgccaac acaccaccac ccaactcacc acctggaacc      2220
     tcaccgacac caccttcacc accgaactca tcgtcagcga actcgtcacc aacgccatcc      2280
     gctacggcca cccacccatc caactccgcc tcatccacca caaccacacc ctcaccaccg      2340
     aagtctccga caccagcaac accacccccc acatgcgccg cgcccgcacc tacgacgaag      2400
     gaggacgcgg cctcctcctc atcggccaac tcgcccaacg ctggggcacc cgccacaccc      2460
     ccaccggcaa aaccgtctgg accgaacaaa ccctcacccc caactaatac tgaattccgc      2520
     tttcgttggg tatag                                                       2535
//

If you have problems or comments...

PBIL Back to PBIL home page