(data stored in ACNUC7421 zone)

EMBL: BA000030.PE113

BA000030.PE113       Location/Qualifiers
FT   CDS_pept        132082..132333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_113"
FT                   /old_locus_tag="SAV_113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_113"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67822"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RN0"
FT                   /protein_id="BAC67822.1"
FT                   /translation="MLRARPGRDEGEREMVHRLASARKAPKVVVERCRTVELSWGGWLV
FT                   PQIADELRCGVGQARTTHPNPQTPLHVHRLRTALIGLH"
     gtgctgaggg cacggccggg ccgtgacgag ggcgagcggg agatggtcca ccgcctggcg        60
     tcggccagaa aggcgccgaa ggttgtggtg gagcgctgtc ggacggtgga gctgagctgg       120
     ggcgggtggc tggtgccgca gatagccgac gagctgcggt gcggtgtggg gcaagcccgc       180
     accacccacc cgaaccctca gacgccgcta cacgtacacc gtttgaggac agcactaata       240
     ggactccatt ag                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page