(data stored in ACNUC7421 zone)

EMBL: BA000030.PE125

BA000030.PE125       Location/Qualifiers
FT   CDS_pept        142975..143661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_125"
FT                   /old_locus_tag="SAV_125"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_125"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67834"
FT                   /db_xref="GOA:Q82RL8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RL8"
FT                   /protein_id="BAC67834.1"
FT                   /translation="MRGPAFMTAPLFAASQLAVNVLSAQSLLAAFGVLGVGVVMFAETG
FT                   LLIGFFLPGDSLLFTAGLLCTGSGQHGVKLSLAPLLVAAAVGALAGAQCGYVLGRKAGG
FT                   ALLARSRSVRLREGAQRAEELLERYGHAKAIVLARFVPVVRTVLNPMAGALGVPARTFT
FT                   VWQVAGGLVWSLGLTLGGYALGSSIPNVDRYLLPIIAVIVAVSLLPLAAELYRSRRAAK
FT                   AKEVRG"
     atgagagggc ccgcgttcat gaccgcaccc ctgttcgcag cctcacagct cgcggtgaat        60
     gtcctgagcg cgcagtccct gctggccgcc ttcggtgtgc tgggggtcgg cgtggtgatg       120
     ttcgcggaaa ccgggctgct gatcggcttc ttcctgcccg gtgactcgct gctgttcacc       180
     gcaggcctgc tgtgcacggg gagcggccag cacggggtga agctgtcgct cgctccgctg       240
     ctagtggccg cggctgtggg tgcccttgcc ggtgcgcagt gcggctatgt gctcggccgg       300
     aaggccggcg gggccctcct ggcgcgcagc cgttcggtcc gcctgcgcga aggggcccag       360
     cgggccgagg agttgctgga gcggtacggg catgcgaagg ccatcgtgct ggcccggttc       420
     gtgcccgtgg tgcggacggt cctaaatccg atggcgggcg cgttgggcgt accggcgcgg       480
     accttcaccg tgtggcaggt cgccggcgga ctcgtgtgga gtctggggct cacgctgggc       540
     ggctacgcgc ttggttcgtc catccccaat gtggaccgct acctgctgcc gatcatcgcc       600
     gtgatcgtgg ccgtgtcgtt gcttccgctc gctgccgagc tctaccgctc ccgccgcgca       660
     gccaaagcga aggaggtacg tggatga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page