(data stored in ACNUC7421 zone)

EMBL: BA000030.PE127

BA000030.PE127       Location/Qualifiers
FT   CDS_pept        144260..144988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_127"
FT                   /old_locus_tag="SAV_127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_127"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67836"
FT                   /db_xref="GOA:Q82RL6"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RL6"
FT                   /protein_id="BAC67836.1"
FT                   /translation="MKRSDLGELAGSVGLGAWTAFGVLTMIVIGDGQPLYGDEDLLSWS
FT                   VGHRPDVPVALARALTATGTGAIPYVLAVLAGTIAGRTLRQRAVATALCLTCLGAGQAA
FT                   RYGVMALVARPRPTRVDWATPASGWAFPSGHTTTAALTAGLLVIAVYTRSPPGRALLAL
FT                   VFGCWGALVGLTRVYLGVHWFTDVVGGWLFAVGWLGLCLCAAAWWLPEAFITGTTDIDQ
FT                   KPPEDHAPQDPGRRGRSRPA"
     atgaaacgca gtgacctcgg cgagctggcc ggcagcgtcg gcttgggggc gtggacggca        60
     ttcggcgtgc tgaccatgat cgtgatcggc gacggccagc cgctgtacgg ggatgaggac       120
     ctgctgtcct ggtccgtcgg gcaccgcccg gacgtgccgg tggcgctggc ccgcgccctg       180
     accgccaccg gaaccggcgc catcccgtac gtcctcgccg tactggcggg aaccatcgcc       240
     ggacgcaccc tgcgccaacg ggccgtcgcc accgcgctct gcctcacctg cctcggcgcg       300
     gggcaagccg cgcggtacgg cgtgatggcg ctcgtcgccc ggccccgccc cacccgagtg       360
     gactgggcca cacccgcctc ggggtgggcg tttccctccg gccacaccac cacggccgcc       420
     ctgaccgccg gactgctcgt catcgccgtg tacacacgct ccccgcccgg cagggccctg       480
     ctcgccctcg ttttcggctg ctggggcgcg ctggttgggc tgacccgcgt ctacctcggg       540
     gtgcactggt tcaccgatgt cgtcggcggc tggctgttcg ccgtcggctg gctggggctg       600
     tgcctgtgcg ccgctgcctg gtggctgccc gaagcgttca tcacaggtac gacggacata       660
     gaccaaaagc cgccggagga ccatgcgcca caagatcctg gtcgtcgagg acgatcacgc       720
     cctgcgtga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page