(data stored in ACNUC7421 zone)

EMBL: BA000030.PE13

BA000030.PE13        Location/Qualifiers
FT   CDS_pept        17828..18922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_13"
FT                   /old_locus_tag="SAV_13"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_13"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67722"
FT                   /db_xref="InterPro:IPR005114"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RX9"
FT                   /protein_id="BAC67722.1"
FT                   /translation="MRSDNNKRAYRTARPEIKGLRAHDEEAIELLAIPQEPQKDVAQPS
FT                   QHIGPPPEEGEDESRLLLRFAAPRDPVMVADWVSFNVIDTEKQDWARGWAALKKFTERE
FT                   QHARVPYGYKEGAYPLGQWVAEQRRAYGAGQMTGQRARRLEQLGMVWSPADERFQENLE
FT                   AARAYLEEHWTLCAPRSATMLDRPVGQWLSNLRRPGALEGHPEWKTALEAVDEDWNPSW
FT                   PAEWQRHYAALRDLVADEEGQADVLPGFTVHGMDIGKWLARQRKPEVWQALTDGQRERL
FT                   EQLGIVPLALEPEEPAKPSATPVGAFERGVAALAQYKAREGSVTVPRAHVERLEDGTEV
FT                   RLGVFLTLELVPLPAPVGPPAPCT"
     gtgcggtccg acaacaacaa acgtgcctac cgaaccgccc gccctgagat aaaaggtctt        60
     cgggctcatg atgaagaggc aatcgaattg ctggcgattc cgcaggagcc gcagaaggac       120
     gtcgcgcagc cgtcccagca catcggtccg ccgcccgagg aaggcgagga cgaatcacgg       180
     ttgctgctcc gtttcgcagc cccgcgtgat ccggtgatgg tcgcggactg ggtgtccttc       240
     aacgtgatcg acaccgagaa gcaggactgg gcccgcggct gggcggcact caagaagttc       300
     accgaacgtg agcagcacgc cagagtcccc tatgggtaca aagagggtgc ttaccctctc       360
     gggcaatggg tcgcagaaca gcgacgcgca tacggggcgg ggcagatgac cggccaacgc       420
     gcccggcggc tggagcaatt gggcatggtc tggtcaccgg ccgatgagcg attccaggag       480
     aacctggaag cggcccgcgc gtacttggag gagcactgga cgctgtgcgc gccccgctcc       540
     gcgaccatgc tggaccggcc ggtggggcag tggctgtcca acctccgccg acccggcgcc       600
     ctggaaggac accccgagtg gaagacggcg ctggaggccg tggacgagga ttggaacccg       660
     tcgtggccgg cggagtggca gcggcactac gccgcgctgc gcgatctggt ggccgacgaa       720
     gagggccagg ccgacgtcct gccgggcttc acggtccacg gcatggacat cgggaagtgg       780
     ctggcccggc agcggaagcc cgaggtctgg caggccctga cggacgggca gcgcgagcgc       840
     ctggagcagc tcggcatcgt gccgctggcc ctggagccgg aggagcccgc gaagccgtcc       900
     gcgacgcccg tgggggcctt cgagcggggc gtggcggccc tggcgcagta caaggcccgg       960
     gaaggctctg tgacggtgcc cagggcccat gtagagcggc tggaggacgg caccgaggtt      1020
     cggcttgggg tattcctgac cctcgagctg gtgcctctcc cagcgccagt gggaccgcct      1080
     gcgccctgta cctga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page