(data stored in ACNUC7421 zone)

EMBL: BA000030.PE130

BA000030.PE130       Location/Qualifiers
FT   CDS_pept        complement(146943..147743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_130"
FT                   /old_locus_tag="SAV_130"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_130"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67839"
FT                   /db_xref="GOA:Q82RL3"
FT                   /db_xref="InterPro:IPR007136"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RL3"
FT                   /protein_id="BAC67839.1"
FT                   /translation="MKIAATTLGETAGDLFAQTLKLGYFLTTIALFLIFVVTLVVQLRS
FT                   RRYNPFFYWTVILSTSMAGTTMSDFMNRDASAKFLSGGATSLGWGPQGLGLGYPVGAAI
FT                   LISLLIAVFAVWKLTGMTFVIRDIVTFRGEALFWSAILVSNTLGTSMGDFLSDSSGLGY
FT                   AGGALLVSGMLAMLLVLMKVPVVPNVLLFWFAFVLTRPLGATAGDFLTKPVAKGGLDLG
FT                   TAGSSAVLLAILVGLMAYAQVRERRTALSSPESAEQEAVTQRAA"
     atgaagatcg ccgccacgac cctgggcgag acggccggtg acctgttcgc ccagaccctg        60
     aagctcggct acttcctcac cacgatcgcc ctgttcctga tcttcgtggt gaccttggtg       120
     gtccagctca ggtcccgccg ctacaacccg ttcttctact ggacggtcat cctgtccacc       180
     agcatggccg gtacgacgat gtccgacttc atgaaccgcg acgccagcgc caagttcctc       240
     tcgggcgggg ccacgtcgct gggctggggc ccgcagggcc tgggcctggg ctaccccgtc       300
     ggcgccgcga tcctgatctc tctcctgatc gccgtcttcg cggtgtggaa actgaccggg       360
     atgacgttcg tcatccgtga catcgtcacc ttccgcggcg aagccctctt ctggtcagcg       420
     attctcgtct ccaacaccct cggcacgtcc atgggcgact tcctctccga cagctccggc       480
     ctcggctacg cgggcggcgc gctgctcgtc tccgggatgc tcgcgatgct tctcgtcctg       540
     atgaaggtgc ccgtggtgcc gaacgtgctg ctgttctggt tcgccttcgt actgacccgc       600
     ccgctgggcg cgaccgcagg tgacttcctc accaagccgg tcgccaaggg cggtctcgac       660
     ctcggcaccg cgggttcatc ggccgtcctg ctggccatcc tggtgggcct gatggcgtat       720
     gcccaggtgc gggagcgccg gaccgccctc tcgagtccgg agtcagccga gcaggaggcc       780
     gtcacccagc gggcagcctg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page