(data stored in ACNUC7421 zone)

EMBL: BA000030.PE132

BA000030.PE132       Location/Qualifiers
FT   CDS_pept        148993..149274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_132"
FT                   /old_locus_tag="SAV_132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_132"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67841"
FT                   /db_xref="GOA:Q82RL1"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RL1"
FT                   /protein_id="BAC67841.1"
FT                   /translation="MTIPHSHGRTCADHATHWLRRRLGRAVALAYLAAVLLPGPGRWLR
FT                   HTHTLVGTGLPLYTASLLLSLVLFSAGLQVPVRALGQLLRRPRACWQG"
     atgaccatcc cccactccca cggccgcacc tgtgccgacc acgcgacgca ctggctgcgc        60
     cgccgcctcg gacgggccgt cgcgctcgcg tatctcgccg ccgtgctgct gcccggcccg       120
     ggccggtggc tgcgccacac gcataccctg gtggggactg gactccccct gtacacggcc       180
     tcgttactgc tctcgctggt cctgttctcg gccggactac aggtccccgt gcgagcactg       240
     ggacagctgc tgcgacggcc ccgggcctgc tggcagggct ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page