(data stored in ACNUC7421 zone)

EMBL: BA000030.PE136

BA000030.PE136       Location/Qualifiers
FT   CDS_pept        152278..153018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_136"
FT                   /old_locus_tag="SAV_136"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_136"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67845"
FT                   /db_xref="GOA:Q82RK7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RK7"
FT                   /protein_id="BAC67845.1"
FT                   /translation="MNTMLVPPSDEALTARELYRFFRAGEEETLALRGVSLRVRRGETV
FT                   AVVGPSGAGKSTLLSCLAGLDEPSGGEVRVDGVRISHRPETERARLRAHHIGVLLQTSN
FT                   LVAHLSVRDNVRLTHSAVRGRPSASVGDLLAEVGLAGRAHALPRQLSGGELARAGLAVA
FT                   LANSPAVLLADEPTGELDGGTERMILQMLRDRAALGCAVLIVTHSAEAVRIADRVIALD
FT                   DGRAHETTTSQARTQQQEAHDAAP"
     gtgaacacca tgctggtccc accgtccgac gaagccctta ccgcgcggga gctgtaccgc        60
     ttcttccggg ccggtgagga ggagacgctc gcgctgcggg gggtgtccct gcgggtgcgg       120
     cgcggtgaga cggtcgccgt ggtcgggccg tccggagccg gcaaatccac cctgctgtcc       180
     tgcctggccg gactcgacga accctcgggc ggtgaggtgc gcgtggacgg cgtacgcatc       240
     agccaccgac cggagaccga acgggcccgg ctgcgcgccc accacatcgg cgtcctgctg       300
     cagaccagca acctcgtcgc ccacctcagc gtgcgcgaca acgtccgcct gacgcacagc       360
     gccgtgcgtg gccggccctc cgcgtccgta ggagacctgc tggccgaggt ggggctcgcg       420
     gggcgggcac acgcgctgcc ccgacagctg tccggcggcg agctggcgcg cgccgggctg       480
     gccgtcgcgc tggccaactc cccggccgtc ctgctggcgg acgaaccgac cggcgaactc       540
     gacggcggca ccgagcgcat gatccttcag atgctgcgcg accgcgccgc cctgggctgc       600
     gcggtgctga tcgtcaccca cagcgccgaa gccgtccgga tcgccgaccg ggtgatcgct       660
     ctggacgacg gcagggccca cgagaccacc acgtcccagg cccgcacaca acagcaggag       720
     gcccacgatg ccgccccgtg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page