(data stored in ACNUC7421 zone)

EMBL: BA000030.PE137

BA000030.PE137       Location/Qualifiers
FT   CDS_pept        153005..153718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_137"
FT                   /old_locus_tag="SAV_137"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_137"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67846"
FT                   /db_xref="GOA:Q82RK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RK6"
FT                   /protein_id="BAC67846.1"
FT                   /translation="MPPRDHAIPAGKPVTSLDEVLVDCRNAALTFGRGATAVVAVHGAN
FT                   LWVRSADRLAIVGPSGSGKSSLLHLLAGLEQTTSGTVTWPALDGPGGIGIVFQGDSLIA
FT                   ALDVVENTALPLVLAGVPDGEAHRLAAEALALVDAADLAERLPEEISGGQAQRVAAARV
FT                   LAQSPRLILADEPTGRLDHTTGGHVLDALLTAADQTGAALVVTTHDPAIAARLTTRLAM
FT                   RGGRLLTVDEPQEAS"
     atgccgcccc gtgatcacgc gataccggcc ggcaagcccg tgacgtcgtt ggacgaggtg        60
     ctcgtcgact gccgcaacgc ggctctcacc ttcggccggg gcgcgaccgc cgtggtggcg       120
     gtgcacgggg cgaacctgtg ggttcgctcc gcagaccggc tcgccatcgt cggcccgtcc       180
     gggtcgggca agtcgtcgct gctgcatctg ctggccgggc tcgagcagac caccagcggc       240
     accgtcacct ggcccgccct ggacggcccg ggcggcatcg ggatcgtctt ccagggcgac       300
     agcctgatcg ccgccctcga cgtggtcgag aacaccgcgc tgccgctggt cctggccgga       360
     gtgccggacg gcgaggcgca tcggttggcc gccgaggccc tcgccctggt ggacgccgcc       420
     gatctggccg agcggctacc ggaggagatc tccggcgggc aggcacagcg cgtcgccgcc       480
     gctcgcgtcc tggcccagtc ccctcggctg atcctcgccg acgaacccac cggccggctc       540
     gaccacacca ccggcgggca cgtcctggac gccctgctga ccgcggccga ccagacaggt       600
     gcggccctcg tcgtcaccac ccacgacccg gccatcgccg cgcgactcac cacccgactg       660
     gccatgcgcg gtggccggct gctcaccgtg gacgaaccgc aggaggcgtc atga             714
//

If you have problems or comments...

PBIL Back to PBIL home page