(data stored in ACNUC7421 zone)

EMBL: BA000030.PE138

BA000030.PE138       Location/Qualifiers
FT   CDS_pept        153715..156363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_138"
FT                   /old_locus_tag="SAV_138"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_138"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67847"
FT                   /db_xref="GOA:Q82RK5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RK5"
FT                   /protein_id="BAC67847.1"
FT                   /translation="MNTAWAGGLARHRAGRLLAALAGIALAVALVAALGSFLTVSKATM
FT                   TQRAVRSVAVDWQVEVQPGADPQAMLSLVRKAPGIRTAVPVGFAHSSAFTAQVQGSTQT
FT                   TGPGMVLGLPDGYQKLFPGGIRPLTGGTSGVLLAQQTASNLHVAPGDTVGIRLPGTGVR
FT                   QVRVAGVVDLPQADSLFQKVGAPTQSQPTAPPDNVVLLPSTTFTSLTAQAPAAGVTTQI
FT                   HAARDAKLPSEPAAAFNTATRGAHNLEARASGAAIVGNNLGAALDSARQDALYAQILFL
FT                   FLGVPGALLAAALTAAVAAAGGERRRQEQALLRLRGLRPGRIATLSGIEAGLVGAGGAA
FT                   AGLGIAALLGRLAFGSASFGTSAGTWILWYALAFVLGAVVAAGAVLVPALRDLRGVTVA
FT                   DTRRAGRRTGSVWWMRYGVDFALLIGSWLIFRASSGNQYALVLAPEGVPSISVSYWAFL
FT                   GPALLWIGSALLLWRLTLLALTHGRRVLARLSLPLAKNLAGTTAAVLSRRRRPLARSVV
FT                   LLALAVSFAISTATFNATYKQQAEVDARLTNGADVTVTEPPEARTPPGAAASLKVSGVR
FT                   HVEALQHRFAYVGSDLQDLYGVRPDTITSATSLQDAYFSGGTAGTLMRKLAKQPDALLV
FT                   SAETVTDFQLSPGDTVNLRIQDAHTKALRTVPFHYVGVAKEFPTAPKDSFFVANASYVA
FT                   QATGSDSVGAFLLDTGGTHQKQIAAHLRRQLGTSATVSDLTQTRGTVGSSLTAVDLAGL
FT                   TRIELAFAVLLAAGAGGLVLALGLAERRRTFAIATVLGATRRQLRGMVLTEAILLTAGG
FT                   LAGGALIGWALSEMLVKVLTGVFDPPPADLAVPGAYLALTAFAATVAVLAAALNGVRRA
FT                   ARPAVEELRDL"
     atgaacaccg cttgggccgg cgggctggcc cgccaccgcg ccggacgact cctggccgcc        60
     ctggccggca tcgccctggc cgtcgccctc gtcgccgcgc taggttcgtt cctcaccgtg       120
     tccaaggcga ccatgacgca gcgcgccgtg cgctccgtcg ccgtggactg gcaggtcgag       180
     gtgcagcccg gcgccgaccc gcaggcgatg ctgtccctgg tgcggaaggc ccccggcatc       240
     cgcaccgccg tcccggtcgg cttcgcccac agctccgcgt tcacggccca ggtccagggc       300
     agcacgcaga ccaccggccc cggcatggtg ctcggcctcc ccgacggcta tcagaagctg       360
     ttccccggcg ggatccgccc gctgaccggc ggtaccagcg gcgtgctgct ggcccagcag       420
     accgcctcca acctgcatgt cgcccccggc gacaccgtcg gcatccggct tcccggaacg       480
     ggcgtacgcc aggtccgggt ggccggcgtc gtcgacctgc cgcaggccga ctccctgttc       540
     cagaaggtcg gtgcccccac ccagtcgcag cccaccgcgc cgcccgacaa cgtcgttctg       600
     ctcccctcca ccaccttcac ctcgctgact gcccaggcgc ccgccgcagg cgttaccacg       660
     caaatccatg ccgcacgcga cgccaagctg ccctccgagc ccgccgccgc gttcaacacc       720
     gcgacccgcg gtgcccacaa cctggaggcc cgcgcctcgg gcgcggcgat cgtcgggaac       780
     aacctgggtg ccgccctcga ctccgcccgc caagacgccc tctacgcaca gatcctcttc       840
     ctgttcctcg gtgtgcccgg cgcactcctg gccgccgcac tgaccgccgc ggtcgccgca       900
     gccggtggtg aacggcgccg ccaggagcag gcgttgctgc ggctgcgcgg actgcggccg       960
     ggccggatcg ccaccctgtc cggcatcgag gccgggctgg tgggggccgg cggcgccgcc      1020
     gccggactcg gcatcgccgc cctgttgggc cgtctcgcct tcggatcggc ctcgttcggg      1080
     acgagcgcgg gcacctggat cctctggtac gcccttgcct tcgtgctcgg cgccgtcgtg      1140
     gccgcgggcg ccgtcctcgt ccccgcactg cgcgacctgc gcggcgtgac ggtcgccgac      1200
     acacgcaggg ccgggcgccg tacaggctcc gtgtggtgga tgcgctacgg cgtggacttc      1260
     gccctgctga tcggttcctg gctcatcttc cgcgcctcgt ccggcaacca gtacgccctc      1320
     gtcctcgccc cggagggcgt gcccagcatc tccgtgtcgt actgggcgtt tttgggcccg      1380
     gccctgctgt ggatcggctc cgcgctgctg ctgtggcggc tcacgctcct cgcgctcacc      1440
     cacggccgcc gcgtcctggc ccggctctcg ctcccgctcg ccaagaacct ggcagggaca      1500
     acggccgccg tcctctcccg ccgcaggcgg ccgctggccc gctcggtggt gctgctggca      1560
     ctcgcggtgt ctttcgcgat ctccacggcg accttcaacg ccacgtacaa gcagcaggcc      1620
     gaggtcgacg cgcggctcac caacggcgcc gacgtcaccg tgaccgagcc gcccgaagca      1680
     cggacgccgc ccggcgccgc cgcttccctc aaggtctccg gcgtacgtca tgtcgaggcg      1740
     ctccagcacc gattcgccta cgtcggatcc gacctccagg acctctacgg cgtacgcccg      1800
     gacacgatca cctccgccac ctccctccag gacgcgtact tctccggagg caccgccggc      1860
     accctcatgc gcaagctcgc gaagcagccc gacgcgctgc tggtcagcgc ggagaccgtc      1920
     accgacttcc agctctcacc cggcgacacg gtcaacctgc gcatccagga cgctcacacg      1980
     aaggcgctgc gcaccgtgcc cttccactac gtgggcgtcg ccaaggagtt cccgaccgcg      2040
     ccgaaggaca gcttcttcgt cgccaacgcc tcctacgtcg cccaggccac aggcagcgac      2100
     tcggtcggcg ccttcctcct ggacaccggc ggcacccacc aaaagcagat cgccgcccac      2160
     ctgcgccgac agctcggcac cagtgccacc gtcagcgacc tcacccagac ccgcggcacc      2220
     gtcggcagca gcctgactgc cgtcgacctg gcgggactga cccggatcga gctggccttc      2280
     gcggtgctcc tggccgccgg ggccggcgga ctggtcctcg cgctcggcct cgccgaacgc      2340
     cgccgcacct tcgccatcgc caccgtgctc ggcgcgacgc gacggcaact gcgcgggatg      2400
     gtcctcaccg aggcgatcct cctgaccgcg ggcggtctgg ccggcggcgc gctcatcggc      2460
     tgggccctct ccgagatgct cgtcaaagtc ctgacaggcg tgttcgaccc tccgcccgcc      2520
     gacctcgccg tcccgggcgc ctatctggcg ctcaccgcgt tcgccgcgac cgtggccgta      2580
     ctggccgccg cgctgaatgg ggtacgccgc gccgcccgac ccgccgtcga agaactccgg      2640
     gatctgtga                                                              2649
//

If you have problems or comments...

PBIL Back to PBIL home page