(data stored in ACNUC7421 zone)

EMBL: BA000030.PE145

BA000030.PE145       Location/Qualifiers
FT   CDS_pept        complement(163767..165950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_145"
FT                   /old_locus_tag="SAV_145"
FT                   /product="putative membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_145"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67854"
FT                   /db_xref="GOA:Q82RJ8"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RJ8"
FT                   /protein_id="BAC67854.1"
FT                   /translation="MFEGFGRLLYRRRKPVLILTLLFAVLSGAYGAGVFGSLTPLGFQD
FT                   PGSDSVRAAKIAEKAFPQRTPDAVIVYRDEDRTVDDPSFQQAVVQQLASLPKSEVTGYL
FT                   DFWTTRMPTQVSHDRHATYVALNLHGSSEKAKEDAYEAVKDKIPAPGLQTLQGGTVPTG
FT                   HQASEKIEHDLRIAEIISAPVLFLLLLVVFGGLTAAFLPLLVGVLSILGSMAVLRTIAN
FT                   ITDVSVFSMSLVTILGLAVAIDYGLLIVSRYREELAAGYTGEAAIGRTLATAGRTVMVS
FT                   GTTVAAALAGLTLFPSTFLKSMSYGGVAAVLLAVLFSLVALPALLAVMGPKVNAFPLRR
FT                   KKAGRPTAAGEGAWYRFGHGLMRRRRVVVVGAAGLLLTLALPFSKIEFGSINAQQLRSS
FT                   SEGRQVFDAMEHDFDGDAVKSIDSLLVLKSDGTSKDQGAALKAYAERLGATEGATSARI
FT                   TGVEGTTARVSVTYDGNPISPHARDLVNRLKDVPEPPGARAYFGGESAVYDDTLDALGE
FT                   TLPWMLLYIAVMTYLLLFLAFGSVLLPLKAIAMNMLSLTATFGVLVWIFQDGHLHNLLG
FT                   FDPTGNIEPNMPIMLFALIFGLSMDYEVFLVSRMREQYDKSGDSTEAVASGLQSIGRLV
FT                   VSAALLMCVPLAAIGMSDVLTIKLFGVGMVFAVLVDVLVVRILLGTAVMRLLGRAAWWA
FT                   PGPLARFYDRFGIKETDMPADDTAGERVPVATG"
     atgtttgagg ggtttgggcg tctgctgtac cgcaggcgaa agccggtgct gatactgacc        60
     ctgctgttcg ccgtcctgtc cggggcctac ggtgccggag tcttcggctc gctgacaccg       120
     ctcggcttcc aggaccccgg ctcggacagc gtgcgcgctg ccaagatcgc cgagaaggcg       180
     ttcccgcagc ggacacccga cgcggtgatc gtctaccggg acgaggaccg caccgtcgac       240
     gacccgtcct ttcagcaggc ggtcgtccag cagttggcgt ccctgccgaa gtcggaggtg       300
     accggctacc tggacttctg gacgaccagg atgccgacgc aggtcagcca cgaccggcac       360
     gccacctacg ttgccctgaa cctccacggc agcagcgaga aggccaagga ggacgcgtac       420
     gaggcggtca aggacaagat cccggcaccc ggccttcaga cgctgcaggg cggaacggtg       480
     cccaccggcc accaggccag tgagaagatc gaacacgacc tgagaatcgc ggaaatcatc       540
     tcggcccccg tgctcttcct gctcctgctg gtcgtgttcg gcggtctcac cgcggccttc       600
     ctcccgctgc tcgtcggcgt gctctccatc ctcggttcga tggccgtcct gcggaccatc       660
     gccaacatca ccgacgtgtc cgtgttctcc atgagcctgg tcaccatcct gggtctcgcg       720
     gtcgccatcg actacggcct gctgatcgtc agccgctacc gcgaggaact ggcggccggc       780
     tacaccggcg aagcggcgat cgggcgcacc ctcgccacgg ccgggcgcac cgtgatggtc       840
     tccggcacca cggtcgcggc ggcgctggcc ggcctgaccc tcttcccgtc gacgttcctg       900
     aagtcgatgt cgtacggcgg tgtggccgcg gtcctgctgg cggtgctctt ctcactggtc       960
     gcgctgcccg ccctgctcgc cgtcatggga ccgaaggtca acgccttccc gctgcgccgc      1020
     aagaaggcag ggcggccgac ggcggcaggg gagggtgcct ggtaccggtt cgggcacggc      1080
     ctgatgcggc ggcggcgggt tgtggtggtg ggcgcggcgg gcctgctgct gacgctcgcc      1140
     ctgccgttct cgaagatcga gttcggttcc atcaacgcgc agcaactgcg gagcagttcc      1200
     gagggccgcc aggtcttcga cgccatggag cacgacttcg acggcgacgc ggtgaagtcc      1260
     atcgactccc tgctcgtgct gaagtccgac ggcacctcga aggaccaggg cgcggcgctg      1320
     aaggcgtacg ccgagcggct cggcgccacc gagggcgcca cgagcgcccg gatcaccgga      1380
     gtcgagggca ccacggcccg ggtgtcggtc acctacgacg gcaatcccat ctcgccccac      1440
     gcgcgcgacc tggtgaaccg gctcaaggac gtccccgaac cgccgggcgc ccgcgcgtac      1500
     ttcggcggcg agtcggcggt ctacgacgac accctggacg cactgggcga gaccctgccg      1560
     tggatgctgc tctacatcgc ggtgatgacg tacctcctgc tgttcctcgc gttcggctca      1620
     gtgctgctgc cgctgaaggc catcgcgatg aacatgctgt cgctgaccgc gaccttcggc      1680
     gtcctggtct ggatcttcca ggacggccat ctgcacaacc tgctcggctt cgatccgacg      1740
     ggcaacatcg agcccaacat gccgatcatg cttttcgcgc tgatcttcgg actctccatg      1800
     gactacgagg tgttcctggt gtcccggatg cgggagcagt acgacaagtc aggtgacagc      1860
     acggaagccg tggcgagcgg gctgcagtcc atcggccgcc tggtcgtgag cgcggcgctg      1920
     ctgatgtgcg tgccgctcgc ggcgatcggg atgagcgatg tgctgaccat caagctcttc      1980
     ggtgtcggca tggtgttcgc ggtcctggtg gacgtgctgg tggtgcgcat cctgctggga      2040
     acggccgtca tgaggctgtt gggcagagcg gcctggtggg ctccgggccc actcgcccgc      2100
     ttctacgacc ggttcggcat caaggagacc gacatgccgg ccgacgacac cgccggcgag      2160
     cgggtccccg tcgccacggg ctga                                             2184
//

If you have problems or comments...

PBIL Back to PBIL home page