(data stored in ACNUC7421 zone)

EMBL: BA000030.PE149

BA000030.PE149       Location/Qualifiers
FT   CDS_pept        complement(169217..169735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_149"
FT                   /old_locus_tag="SAV_149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_149"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67858"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RJ4"
FT                   /protein_id="BAC67858.1"
FT                   /translation="MSETLDSAATTIARWRSAEERGDVDAAVACLSPDVVLSSPLTDQF
FT                   RFEGSDQLRDFLTSAFAAVKDVHYHTQTGEGDTYALVYRARVGSQSFEEVQMLRLDNQA
FT                   RITEITLFGRPMPALTALMHLMGPALARQQGRRGLATLMSVSTVPIHAMVSSGDRSMVA
FT                   KTRPAARQP"
     gtgtccgaga ccctggactc cgccgctact accatcgcgc gctggcgctc cgccgaggaa        60
     cgcggtgatg tcgacgccgc ggtcgcgtgc ctgagcccgg acgtcgtgct cagctcgcct       120
     ctcaccgacc agttccgctt cgagggatct gaccagctgc gtgacttcct gacctcggcg       180
     ttcgcggcgg tcaaggacgt ccattaccac acccagaccg gcgagggcga cacctacgcc       240
     ctggtctacc gggcgcgggt gggttcccag tcgttcgagg aggtgcagat gctgcggctc       300
     gacaaccaag cacgcatcac ggaaatcacg ctcttcgggc gtccgatgcc ggccctcacc       360
     gccctgatgc acctcatggg tccggcgctc gcccgccagc agggccgccg gggccttgcg       420
     acgctcatga gcgtcagcac cgtacccatt cacgcgatgg tctcctcggg ggaccgcagc       480
     atggtcgcga agacccgccc ggcagcccgg cagccctga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page