(data stored in ACNUC7421 zone)

EMBL: BA000030.PE15

BA000030.PE15        Location/Qualifiers
FT   CDS_pept        21562..22080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_15"
FT                   /old_locus_tag="SAV_15"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_15"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67724"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RX7"
FT                   /protein_id="BAC67724.1"
FT                   /translation="MLPADPLLGTDQQEVVARLWKRQQTETGWAYLVGLPSYRDREDGD
FT                   VEAAAYRVWVRAPDHVRPVDGVDYDQVVTEKLERSPQSAVREVLGERRPSGWVLAKLRD
FT                   GRGPARSVLHAPDCEEAPAGAPLLDMDRALDSAEHPGTRLCTLCGAAQELTPLLRGFDH
FT                   ITDSAPDDS"
     atgctgcccg ccgatcccct gctcggcacc gatcagcagg aagtcgtggc gcggctgtgg        60
     aagcggcagc aaaccgagac gggatgggcc tacctcgtgg ggctgccgtc ctaccgagat       120
     cgcgaggacg gcgatgtgga ggcggcggcg taccgggtat gggtgcgcgc tcccgaccac       180
     gtccggccgg tcgacggcgt cgactacgac caggtcgtca ccgagaagct ggaacggtca       240
     ccgcagtcgg cggtccgtga ggtcctcggg gagcgccggc cttcggggtg ggtgcttgcg       300
     aagctgcgcg acggccgcgg cccggcccgc tccgtcctgc acgcaccgga ctgcgaggaa       360
     gcaccggcgg gggcgccgct gctcgatatg gaccgcgcac tggactcggc agaacacccg       420
     ggcacccggc tgtgcacgct gtgcggagcc gcgcaggagc tgacacctct gctgcgcggc       480
     ttcgaccaca tcaccgactc cgcccccgac gactcctga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page