(data stored in ACNUC7421 zone)

EMBL: BA000030.PE157

BA000030.PE157       Location/Qualifiers
FT   CDS_pept        complement(177538..179952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_157"
FT                   /old_locus_tag="SAV_157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_157"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67866"
FT                   /db_xref="GOA:Q82RI6"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RI6"
FT                   /protein_id="BAC67866.1"
FT                   /translation="MTQPDRILSDPCGTIVDMVARVEPDLTVEQIRDAVKQAAPSRTAR
FT                   RSLAKTLTADPALLTSRRPEGSRSVERLIHKLLAHGARQVAVPLCAGCGKPEPLPQRRG
FT                   KLRVCAYCDATARAQQQPCADCGLPRVIRYTGRNGEGLCSSCQPKDNIDWAQRICDHIA
FT                   TVDPTVPAETVRQIITTITRGRPHYVRRLAWDLEDRPGMLTGNAGHGTPKVIALIDALR
FT                   DAGAQAIVRPPCPHCGRTSVTLRNTLGDVRVCPTCYNTRKAVNCSRCKRRSPVARRSPD
FT                   GQSICNHCDRTDPINHEECSGCGRLRPIIRRNSPTGPLCDTCYRPPVAICLLCGHARPC
FT                   FGVAGGMPRCENCTRLREPCLDCGRTMPVKARTANGPLCETCFKKNPVSFKACTRCGTV
FT                   ERLRHHGLCHRCACNEELTALLAGPDGAVAAPLMQLHSTLMASNHVRVLDWLQKRNTAV
FT                   SVLREIATAECSLDHESLDARTDKAVEHLRAILVAAGALPRRDEQLVAAERWIAAAVAA
FT                   IADLSDRHTIQAFATWTHLTRLRKYSRRKPITAGQAVSARRSVKAAVGFLAWLRAEGLN
FT                   LEAVGQRDLDRWLEGGPTTRQYARDLVLWAVRTKRATNISIPARLKNSPTQALDEDERR
FT                   EIAHRLLGDDQLDARDRVAGLLSLLYAQPFSVIIRLTADHVVVREKSVLLRLGKEPLEL
FT                   SPELGNLIQQIAADRRRDGQIGQIDAHWLFPGIRPGQHLSHITLAARLKRLGIRSLPSR
FT                   TAAIRDLTAEVPAAVVNRLLGLSTSTATSWAKRTAKTSYAAEIARRSDSDK"
     gtgacccagc ccgaccggat cctctctgat ccctgcggca ccatcgtgga catggtcgcg        60
     cgggtcgagc ctgatctgac tgtggagcaa atccgggatg cggtgaagca agccgccccc       120
     agccggaccg cacgccggag cctggcaaaa acattgacgg ccgatcccgc actgctgacg       180
     tccaggcgcc ccgaaggctc tcgttccgtc gaacggctga tccacaagct cctggcacac       240
     ggcgcccgcc aagtcgccgt tcccctctgc gccggctgcg gcaagcccga acccctcccg       300
     cagcgacgag ggaaactccg cgtctgcgcc tactgcgacg ccaccgcacg agcccagcaa       360
     cagccctgcg ccgactgcgg attgccccgg gtcatccgtt acacgggccg caatggcgaa       420
     ggactctgca gcagctgcca gccgaaggac aatatcgact gggctcagcg gatctgcgat       480
     cacattgcca ctgtcgaccc cacggtcccg gcagagaccg tccgccagat catcaccacc       540
     attacccgcg gccgtcccca ctacgtccgg cggctggcct gggacctgga ggaccggccc       600
     ggaatgctga ccgggaacgc cggccacgga acccccaagg tcatcgcgct gatcgatgcc       660
     ctccgggacg ccggagcgca agccatcgtc cgcccgccct gcccccactg cggccgcacc       720
     agcgtgacgc tccgcaacac cctgggagat gtcagggtct gcccgacctg ctacaacacc       780
     cgcaaggccg tcaactgctc tcgttgtaag cgccgctctc ccgtcgcccg ccgcagcccc       840
     gacggacaat ccatctgcaa ccactgtgac cggaccgacc cgatcaacca tgaagaatgc       900
     tccggatgcg gccgactccg gccgattatc agacgaaaca gcccgaccgg ccccctctgt       960
     gacacctgct accggccacc cgtcgcaatc tgcctgctct gcgggcacgc ccgcccgtgc      1020
     ttcggcgtcg ccggcggcat gccacgctgc gaaaactgca cgcgtttgcg agaaccctgc      1080
     ctggactgcg gccgcaccat gcccgtcaag gcccgaaccg ccaacggccc cctttgcgag      1140
     acctgcttca agaagaaccc cgtctccttc aaggcctgca cccgctgcgg cacggtcgaa      1200
     cgactccggc accacggcct ctgccatcga tgcgcctgca atgaggaact caccgcgttg      1260
     ctggcaggcc ctgacggagc cgtcgcagcc ccactcatgc aacttcactc gaccctgatg      1320
     gccagcaatc acgtccgcgt cctggactgg ctacaaaagc ggaacacagc agtctcggta      1380
     ctccgcgaga tagccaccgc agaatgctcc ctcgaccatg aatcactcga tgcccgaaca      1440
     gacaaggccg tcgaacacct tcgggccatc ctcgtcgctg ccggcgccct gccgcgacgc      1500
     gacgaacaac tggtcgcggc agagcgatgg atcgccgccg ctgtcgctgc cattgcagat      1560
     ctctccgacc gccacaccat ccaggcattt gccacctgga cccacctgac tcgtctgcgt      1620
     aagtactccc gtcgcaagcc catcaccgct ggccaggcgg tgtccgcccg ccgcagcgtc      1680
     aaggcagcgg tcggcttcct ggcctggctg cgagccgagg gcctgaatct tgaggctgtc      1740
     ggccagcgtg atctcgaccg ctggctggaa ggcggcccca ctacacggca atatgctcgt      1800
     gacctggttc tctgggccgt ccgcaccaag cgagcgacaa acatcagcat cccggcgcgt      1860
     ctcaagaact ctccgaccca agctctcgac gaggacgaac gaagagagat cgcccaccgg      1920
     ctcctcggcg acgaccagct cgacgcacgc gaccgtgttg ccggcctgct gagtcttctc      1980
     tacgcgcagc ctttcagcgt gatcatccgt ctcactgccg atcacgtcgt cgtgcgcgag      2040
     aagagcgtcc tcttgcgcct cggcaaggag cctcttgaac tatctcccga actgggcaac      2100
     cttattcagc agatcgcggc tgatcgccgc cgcgacggcc agatcgggca gattgacgct      2160
     cattggctgt tccccggaat ccgtccgggc cagcacctca gccatatcac tctcgctgcc      2220
     cgactcaagc ggctgggtat ccggtccttg cccagccgca cggcggctat ccgcgacctg      2280
     accgccgaag tcccagccgc agtcgtcaac cgccttctcg gcctcagtac ctcaaccgct      2340
     accagctggg ccaagagaac ggctaagact tcatacgctg ctgaaattgc ccgccgaagt      2400
     gactcggaca agtga                                                       2415
//

If you have problems or comments...

PBIL Back to PBIL home page