(data stored in ACNUC7421 zone)

EMBL: BA000030.PE162

BA000030.PE162       Location/Qualifiers
FT   CDS_pept        182945..183952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_162"
FT                   /old_locus_tag="SAV_162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_162"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67871"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RI1"
FT                   /protein_id="BAC67871.1"
FT                   /translation="MRFPVQETLPFEDLPEVPTASPWCQRWREGRHSWAHVRDGGFDAR
FT                   RYTVDVIPDEEPAKGFVLAHHYSGSYPAVTVQFGLYDVVDGERRLCGVAVFGVPVSTAV
FT                   LTKPLPELRPYTESLVCSRFVLLDECPANSESWFLANCLKRLLARGVHGVVSFADPVPR
FT                   RTASGLLVMPGHVGTIYAATNAVYASRATARTVSQQRLDELCAEVEQIAELLVARPEAA
FT                   GEAIEAFNAMTGHDYVALDFAEYYGSRSLEEFAKEAARPARPVVADINRDELVEIVRRL
FT                   LTASAESGYYLRLLEANVSHPRVSDLVFHPSDILQDPSAEQIVDEALKYRPIAL"
     gtgaggttcc cggtccagga gaccctgccg ttcgaggacc tgccggaggt accgaccgcg        60
     tccccctggt gccagcggtg gcgcgagggg aggcattcct gggcgcatgt ccgcgacgga       120
     ggcttcgacg cccgccgata caccgtggac gtcatccccg acgaggagcc cgccaagggg       180
     ttcgtgctcg cacaccatta ctccggctcg tacccggcgg tgacggtgca attcggcctg       240
     tacgacgtcg tcgacggcga gaggcggctc tgcggggtgg ccgtgttcgg agtgccggtc       300
     agcaccgccg tcctcaccaa gccactgccc gagctccggc cgtacaccga gtcgttggtg       360
     tgctcgagat tcgtcctgct ggatgagtgc ccggcgaatt cggagtcgtg gttcctcgcg       420
     aactgcctaa aacgcctgct cgccaggggt gtacacggag tcgtctcgtt cgcggaccct       480
     gtcccgcgcc ggaccgcttc gggacttctg gtcatgcctg ggcacgtcgg cacgatctac       540
     gcagccacga acgcggtcta cgccagccgg gccaccgccc ggacggtgag ccagcagcgg       600
     ctggacgagc tgtgcgcgga ggttgagcag attgctgagc tgctggtcgc ccgcccagag       660
     gcggcgggcg aggcgatcga ggcgttcaac gcgatgaccg gtcacgacta cgtggctctc       720
     gacttcgctg agtactacgg cagcaggagc ctggaggagt tcgcgaagga ggcggcccgg       780
     ccggctcgcc ccgtggttgc ggacatcaac cgggacgagc tcgttgagat cgttcgcaga       840
     ctcctgactg cctctgcgga gagcggctac tatctgcggc tcctggaggc gaacgtgtcg       900
     catccccggg tgagtgacct ggtcttccat ccctcggaca tccttcagga cccgtctgcg       960
     gagcagattg tcgacgaggc tctgaagtac cggccgatcg cgctctga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page