(data stored in ACNUC7421 zone)

EMBL: BA000030.PE165

BA000030.PE165       Location/Qualifiers
FT   CDS_pept        185890..186507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_165"
FT                   /old_locus_tag="SAV_165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_165"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67874"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RH8"
FT                   /protein_id="BAC67874.1"
FT                   /translation="MYQAFTPQVRALRKETDGPLMFANVLGMRAEESPDRRNREMWRRT
FT                   TDNSARIVDEWLPAHQVSTEEVWERTISAGLPYHWCYDSYPGAKDRGGSSRCSCSACTL
FT                   ANHRDLLLTAGRRPRMAELCALVERVRQVPFNPNITMAELIALSRRRDAPDPGVLVEET
FT                   EDFERMERDVHAALRKPPTWDSKARTGPGEILHSAAGCDGCH"
     gtgtaccagg cgttcacccc gcaggtccgc gcgctcagga aggagacgga cggcccgctg        60
     atgttcgcca acgtgctcgg gatgcgggcc gaggagagcc cggaccgacg caaccgggag       120
     atgtggcgcc gtactaccga caactcggcc cggatcgtcg acgagtggct gcccgcgcac       180
     caggtgagca ccgaggaggt ctgggagcgc acgatcagcg cggggctgcc ctaccactgg       240
     tgctacgact cgtaccccgg tgccaaggac cggggtggtt ccagtcgctg ttcgtgctcg       300
     gcctgcaccc tggccaatca ccgcgatctg ctgctgaccg ccgggcgccg gccgcggatg       360
     gccgagttgt gcgcgctggt cgaacgtgtc cgccaggtgc cgttcaaccc gaacatcacc       420
     atggccgagc tcatcgcgct gtcccgccgg cgcgatgccc cggaccccgg cgtcttggtc       480
     gaggagaccg aggacttcga gcggatggaa cgcgacgtcc acgccgccct gcgcaagccg       540
     cccacatggg actccaaggc ccgtaccggg ccgggcgaga tcctgcacag cgccgccggg       600
     tgcgatggct gccactga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page