(data stored in ACNUC7421 zone)

EMBL: BA000030.PE167

BA000030.PE167       Location/Qualifiers
FT   CDS_pept        187026..187742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_167"
FT                   /old_locus_tag="SAV_167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_167"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67876"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RH6"
FT                   /protein_id="BAC67876.1"
FT                   /translation="MTSRREPRLADAAEIAAEQGLTPSRISQFYTERAENAAGRTFPDP
FT                   VDKRGRARLWNHAEVTEWFADRAPSRLAEHAPPSLPPGTLLNAAEASRYLGYKNSSQVT
FT                   TFVRDHPGYFPEPDVVEEKGTAANPYRRQLWKVETLQAWMATRPGRGRRAGAKEAPPLP
FT                   DVPVDGDPEELLGASQAAALLGYKTVGSFSSSLSQGNLPLLKTTDGVAENAGRQNGRRR
FT                   WTRRRILEQAAQRSKK"
     atgacctcgc gccgtgagcc tcgcctggcc gacgctgccg agatcgcggc tgaacagggc        60
     ctgacaccct cacggatcag ccagttctac accgagcgcg cggagaacgc ggccggcagg       120
     acattccccg atcctgtcga caagcgcggc cgcgcccgcc tgtggaacca cgcggaggtc       180
     accgagtggt tcgccgaccg ggcgccgtca cggctcgctg aacacgcacc gccctccctc       240
     cctccgggga cgttactgaa cgcggcggag gcctcgaggt atctcggcta caagaactcc       300
     agccaggtca cgaccttcgt gcgcgatcac cccggttact tccccgagcc ggatgtcgtc       360
     gaagagaagg gcacggcggc gaacccctac cgccggcagt tgtggaaggt agagactctg       420
     caggcgtgga tggccacccg gcccggccgc ggaagacgag ccggagccaa ggaggcgccg       480
     ccgctgcccg acgtgccggt cgacggcgat cccgaggagc ttctgggggc gagccaggcg       540
     gccgccctgc tggggtacaa gaccgtcggc tccttctcga gcagcctgtc ccagggcaac       600
     cttccgctac tgaagaccac ggacggggtc gcagagaatg ccgggcgcca gaacgggcgc       660
     cggcggtgga cgcgccggcg catcctcgag caggcagccc aacggtccaa gaagtag          717
//

If you have problems or comments...

PBIL Back to PBIL home page