(data stored in ACNUC7421 zone)

EMBL: BA000030.PE168

BA000030.PE168       Location/Qualifiers
FT   CDS_pept        188180..189094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_168"
FT                   /old_locus_tag="SAV_168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_168"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67877"
FT                   /db_xref="InterPro:IPR025855"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RH5"
FT                   /protein_id="BAC67877.1"
FT                   /translation="MNSAAQSIPATAMAPTPAEPLTHQVLAGLAQHRIATTSQMRRMLR
FT                   PDGTRQLMSRVLNRLRSDGFVDCTVLPDANRTRTNAWYLTQEGARLTRDLPVLRGRPPY
FT                   PISSMTAASLKTPHTLAVVRAHLAFAADARRLGHEHGPWDWTPEVSHSIGEGERIVADA
FT                   VMYYTVVESEHRRKLRAFVEVDRSTMSSERLAVKLIEYARLFQYEAQPVGRRRQASVGP
FT                   AWLRWYPVFPRVLFVLTGASRVRLENRMSDLQAMVAQHPLVAGLAREVRLGAAVLEDLE
FT                   QHGPAQDVWMPLVGGNSRPWTDL"
     atgaacagcg ccgcacagag tattccggcg acggcaatgg cccccactcc cgctgagccc        60
     ttgacccacc aggtgctggc cgggctcgcc cagcaccgca tcgccaccac cagccagatg       120
     cgtcggatgt tgcgaccgga cggcacgcgg cagctgatgt cccgcgtgct gaacaggcta       180
     cgttccgacg gcttcgttga ctgcacggtg ctgccggacg cgaaccgaac ccgtaccaac       240
     gcctggtacc tcacgcagga gggcgcacgg ctgacccggg acctgcccgt cctacgagga       300
     cggccgccct accccatctc ctcgatgacg gcagcatcgc tgaagacccc gcacacgctc       360
     gccgtcgttc gcgctcacct tgctttcgcc gcagacgccc gccggctcgg gcacgagcac       420
     ggcccctggg actggacccc tgaggtgtcc cactccatcg gtgagggtga gcggatcgta       480
     gccgacgcgg tgatgtacta cacggtcgtc gagagcgaac accggcgaaa gctgcgcgcg       540
     ttcgtggaag tcgatcgcag caccatgagc agtgagcggc tggccgtgaa gctgatcgag       600
     tacgcccgcc tgttccagta cgaggcccag cccgtcggcc ggcggaggca ggcgtccgta       660
     ggtcctgcgt ggctgcgctg gtatccggtt tttccccgtg tgctcttcgt gctcacaggt       720
     gcctcccggg tcaggctgga gaatcggatg agcgatctgc aggcgatggt ggctcagcac       780
     ccactcgtgg cgggtctcgc tcgggaggtc cggctgggag ccgccgtgct tgaagacctg       840
     gagcagcacg gtcccgccca agacgtgtgg atgcctctgg tcggaggtaa ttcgcgcccg       900
     tggacggacc tgtga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page