(data stored in ACNUC7421 zone)

EMBL: BA000030.PE182

BA000030.PE182       Location/Qualifiers
FT   CDS_pept        207837..208697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_182"
FT                   /old_locus_tag="SAV_182"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_182"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67891"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RG1"
FT                   /protein_id="BAC67891.1"
FT                   /translation="MDGHGVDRERSSLLTRRLSLLIGALVLAAAGTAHADDDPDVGAGK
FT                   CQVIKFCVGVGVDDETGGKGTQTGSQGSSGSKTQCKLTKVNPKPPANHPVWNGADPKKS
FT                   DLYFRACTDGGDGFVVVPQGQPAPQVDPQELAQRAVDSMTLLGPDIASPRGAGKYTVGV
FT                   PTWMWVNQSATTFGPNTASASAGGITVTATAKVSKIVWQMGDGASVTCNGPGTPYQASE
FT                   GMAQSPNCGHVYSKSSAGARSGKYPVTATSTWTIDWQGGGAAGQLTEIRQTNVQVAIGE
FT                   LQVVR"
     gtggatggtc acggagttga ccgcgaaaga tcaagcctgc tgacccggcg cctgtcatta        60
     ctcatcggcg ccctcgtcct ggccgcggca ggcaccgcgc acgccgacga cgaccccgat       120
     gtcggggcgg gcaagtgcca ggtcatcaag ttctgcgtcg gcgtcggcgt ggacgacgag       180
     accggcggga agggcaccca gacgggctcg cagggcagca gcggcagcaa gacgcagtgc       240
     aagctgacca aggtcaaccc gaagccgccg gccaaccatc cggtctggaa cggcgccgac       300
     cccaagaaga gcgacctgta cttccgcgct tgcacggacg gcggcgacgg tttcgtcgtc       360
     gtaccgcagg gccaacccgc accccaggtg gacccgcagg agctggcgca gcgcgcggtc       420
     gactcgatga cgctgctcgg cccggacatc gccagcccgc gcggggccgg gaagtacacg       480
     gtcggtgtgc cgacgtggat gtgggtcaac cagagtgcca cgaccttcgg gcccaacacc       540
     gcgtcggcct cggcgggcgg gataaccgtc accgctaccg cgaaggtctc caagatcgtg       600
     tggcagatgg gcgacggcgc ctccgtgacg tgcaacggcc cgggcacgcc gtaccaggcg       660
     tccgagggca tggcccagtc acctaactgc ggacatgtgt attccaagag ctcagctggt       720
     gcccgcagcg gcaagtaccc ggtgaccgcg acgtcgacgt ggacgatcga ctggcagggc       780
     ggcggagctg ccggccagct caccgagatc cggcaaacca acgtgcaggt ggcgatcggc       840
     gagctgcagg tcgtcagata a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page