(data stored in ACNUC7421 zone)

EMBL: BA000030.PE188

BA000030.PE188       Location/Qualifiers
FT   CDS_pept        213608..213823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_188"
FT                   /old_locus_tag="SAV_188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_188"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67897"
FT                   /db_xref="GOA:Q82RF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RF5"
FT                   /protein_id="BAC67897.1"
FT                   /translation="MKHTAARTYRAVHWATTRLQEGLEEAKRRPDRGDISTTTVIIWVA
FT                   AVTGAVLIAGTIAVVISKYNGKLTGL"
     atgaagcaca ccgcagcccg cacctaccgt gcggtgcact gggcgaccac gcgtctgcag        60
     gagggcctgg aggaggccaa gcgcaggccg gaccgcggcg acatcagcac caccaccgtc       120
     atcatctggg tggctgccgt caccggcgct gtactgatcg ccgggaccat cgccgtcgtg       180
     atctccaagt acaacggcaa gctcactggg ctgtga                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page