(data stored in ACNUC7421 zone)

EMBL: BA000030.PE189

BA000030.PE189       Location/Qualifiers
FT   CDS_pept        213820..214248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_189"
FT                   /old_locus_tag="SAV_189"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_189"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67898"
FT                   /db_xref="GOA:Q82RF4"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RF4"
FT                   /protein_id="BAC67898.1"
FT                   /translation="MMSPPARLKDWWQGRRWGDDRGDTSIQMAIIFPFVLIATVAVIQV
FT                   SMWYYARQIALTAAREGLTAARAYESGPADGAAQAREVLGRVAGDSLRGYSVSASSNGQ
FT                   RVRVQVSGTAMSMIPGVPGLQVTQSASGPVERWTVPGR"
     gtgatgtctc ctccggcgcg gctgaaggac tggtggcagg gacgacgatg gggcgacgac        60
     cgcggtgaca cctccatcca gatggcgatc attttcccgt tcgtgctgat cgccacggtg       120
     gccgtcatcc aggtctccat gtggtactac gcacggcaga tcgccctgac cgctgctcgc       180
     gagggcctca ccgcggcccg cgcctacgag tcgggtccgg ccgacggtgc ggcccaggca       240
     cgggaggtgc tggggcgcgt cgcgggtgac agcctgcgcg gctacagcgt gtccgccagc       300
     agcaacgggc agcgggtgcg ggtacaggtc tccggcacgg ccatgtcgat gatcccgggc       360
     gttccgggtc tgcaggtcac ccagtcggcg tccggtcccg tggagcgctg gacggtcccg       420
     ggaaggtga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page