(data stored in ACNUC7421 zone)

EMBL: BA000030.PE190

BA000030.PE190       Location/Qualifiers
FT   CDS_pept        214245..214706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_190"
FT                   /old_locus_tag="SAV_190"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_190"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67899"
FT                   /db_xref="GOA:Q82RF3"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RF3"
FT                   /protein_id="BAC67899.1"
FT                   /translation="MNYVRYMARWARRLRSDEGSAAIEAAIILPSLIMFLWLAIAGGRL
FT                   VTSGSKIDAAAEDAAREASIHRTAGAAQSAAHAAAAESLNDQGITCASTSVSVNTGGLS
FT                   VPVGQVGTVTVTVTCTVDLSDLLLPGVPGARTLTSTATSVVDQYRQRGD"
     gtgaactacg tgcgatacat ggcccgatgg gctcgcaggc ttcgcagcga tgagggcagc        60
     gccgcgatcg aggcggccat catcctcccg tcgctgatca tgttcctgtg gctggctatc       120
     gccggggggc gcctcgtcac ctctggctcg aagatcgacg cggcagctga agatgcggcc       180
     agggaggcgt ccattcaccg tacggcgggt gccgcccaga gtgccgcgca cgcggcggcc       240
     gccgagtcgc tcaacgacca gggcatcacg tgcgcgtcga ccagcgtcag cgtcaacacc       300
     ggcggcctca gcgtgccggt gggccaggta gggacggtca ccgtgaccgt gacctgcacg       360
     gtcgatctgt cggatctcct gctgccgggc gtgcccgggg cccggaccct cacgtcgaca       420
     gccacctccg tagtggatca gtacaggcag cgaggtgact ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page