(data stored in ACNUC7421 zone)

EMBL: BA000030.PE195

BA000030.PE195       Location/Qualifiers
FT   CDS_pept        complement(221399..222835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_195"
FT                   /old_locus_tag="SAV_195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_195"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67904"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RE8"
FT                   /protein_id="BAC67904.1"
FT                   /translation="MQRHRALDAQRRCSASLVNGRLRAGQRKKRRGPVGLGPEIFTFGG
FT                   PESGVEDYRGAVTANVNLAAAMERSGLSQGELASRLNQRIEALTGKLGALSDRHVRHWL
FT                   AGKTRWPHKRQRIVLEAEFGVSAEELGFIPPPRRTPALSEDDDVRRRAFTTATASLTAA
FT                   ALRPAHLSSGASRVGMVDANRLEENFARLVAADAATGLTVGLETRAVAHAQHALDLMAI
FT                   GHASERVRRRLYFLAAAFMGTALWAALDRMETARAGRHLDRGLRLARLSGDAGMEMRMW
FT                   GHAALLHLQQRQFPDALAAAQMGRETQVCRRDPLFRSLAAARLAGVQSGAGERAAAVRT
FT                   LGQAEVAYERATPEQLRPAYMDFYDRAEFEGLAGLVMMRLGRNEESEAHLHRALSGLRP
FT                   DYHRNRVYYTVLLATTQLRQGDADAACATALTKLPDDPDSLSGRTKALFARFDQDLTTE
FT                   AAGAHFVTEWADRYSRGGIA"
     gtgcagcggc accgggcact tgacgctcag cgccgttgct ctgcctcgtt agtcaacggg        60
     cgactacgcg cagggcaaag gaaaaagcgg agagggcccg tcggcctcgg accggaaatt       120
     tttaccttcg gagggccgga gtccggggta gaggactacc gtggggccgt gacggcgaac       180
     gtcaatctcg cagcagctat ggagcggtct ggactaagtc agggggagtt agcaagccgt       240
     ctgaaccagc ggatcgaggc gttgaccggg aaactcggcg cgctgtccga tcggcacgtc       300
     cgacactggc tcgccgggaa aactcgctgg ccgcataaga gacaacggat cgtcctcgaa       360
     gcagagttcg gagtgagcgc ggaggaactg ggcttcatac ctccccctcg tcgtacccct       420
     gcactatcgg aggatgatga cgtgcgtcga cgcgccttca ccacggcgac cgcatccctc       480
     acggccgccg ctttacggcc cgcccatctg tccagtggtg cttcccgcgt tgggatggtc       540
     gacgccaacc ggctggaaga gaactttgct cgcttggtgg ccgcggacgc cgcgacgggt       600
     ctcaccgtcg gcctagagac ccgggccgtc gcccatgccc agcacgcttt agacctcatg       660
     gccatcggcc acgccagcga gcgcgttcgc cgacgcctgt acttcctcgc cgccgccttc       720
     atgggcaccg ccctgtgggc ggccctggac cggatggaga ccgcgcgcgc gggacggcac       780
     ctcgaccgag gcctgcgcct tgcgcggctc tccggcgatg ccgggatgga gatgcggatg       840
     tggggccacg ccgccctgct tcacctccag cagcggcagt tccctgacgc cctcgccgcg       900
     gcgcagatgg gccgggagac tcaggtgtgc cgccgcgacc cgcttttccg gtccttggcc       960
     gccgcccgtc tggctggtgt gcagtcggga gctggagagc gtgctgcagc cgtgcgaacc      1020
     ctcggccagg cagaggtcgc gtacgagcgc gccaccccag agcagctccg cccggcctac      1080
     atggacttct acgaccgggc cgaattcgag gggttggccg gcctcgtaat gatgcggctg      1140
     ggccggaacg aggagtccga agcccaccta caccgcgcgc tgtccggcct gcggcctgac      1200
     tatcaccgca accgcgtcta ctacacggtc ctcttggcga cgacacaact tcggcaaggg      1260
     gacgcagacg cagcatgcgc taccgcgctg acgaaattgc cagacgaccc tgattcactg      1320
     tcagggcgca ccaaggccct gttcgcgcgt ttcgaccagg atctgaccac tgaggcggcc      1380
     ggagcacact tcgtgaccga gtgggccgac cgttattccc gaggaggaat tgcgtga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page