(data stored in ACNUC7421 zone)

EMBL: BA000030.PE200

BA000030.PE200       Location/Qualifiers
FT   CDS_pept        complement(229825..236937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_200"
FT                   /old_locus_tag="SAV_200"
FT                   /product="putative large secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_200"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67909"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RE3"
FT                   /protein_id="BAC67909.1"
FT                   /translation="MAARRTRFLSAGVAGAVLAGLLSTMSVVAPQQAFATADDPTPVVP
FT                   SQSLGSVPAQQAEEVGKALPDPKWPNAAEATVDLSQAAPGDPGTVTPSPTTTGSENSTQ
FT                   VGDVVDVAPAPDPVGATTQLSAQRRADGDVSPSPSASSSTDASTSPSPEASTSSSPQPP
FT                   DSVTSEPDQDPVSPDQVQVRVLDHQTVEPAGGIGLGLQVNRTDGVNAPGQVQVDVDYSG
FT                   FQYAYGADFASRLRLVKLPACALQTPEAEGCTDREFVPVDNDTATGTLTATVTAAADTE
FT                   VSGASTQLMREASASGASVYTLASGSSSDAGDYRASTLSPTGSWEVSTGSGAFTYNVPI
FT                   QLPKPPMGSAPSLSLSYNSQSVDGRTSASNNQASWAGMGWDLNVGYIERRYRNCSEDGL
FT                   PTIGDMCWDSPNSAKEPSGAVYVINLNGVTSELIQDNTGSGAYHLKNDPGWRVQRLFDG
FT                   YGAGRDGEYWVISTQDGQRYYFGWGRSERTGTATASVFTEPVVGNDTGEPCHDQFPEPC
FT                   TQAWRWSLDRAVDANEVETMYFYDKEYNHYRSVANSDKAREYVSSGYVKEIQYGWSSQI
FT                   PDGKLPAKVELSHVNRCIERVQENDPLRDEPATCPTFDDKPTSYPDVPVDLMCDGTSAD
FT                   YNCAGKTYYPTFFSTDMLWDVKTYVSDQDGTGWDLVEQYQNKYGMPNPDGTIGKTLWLD
FT                   YIQRKTYGDGDDIVLPVINFNRTDLDNKVGSAELNFPRIQEIHGDLGATTKVSYGFANA
FT                   CDIDHLPTQASNTQDCYWQKWTPEGETESKTGWFKKFLVTKVEVDPTVTTNQDGAPVMT
FT                   TSYTYEGGAGWRFTGDPLVKDEDESWSDWRGYQETQVTTGADTGQKTKKYWLYRGLDGD
FT                   RTSKTDTSATKTVTVNDGDGNNYADHAWLAGHTLSTSLRDDTDISHERTYHTYWSHNTA
FT                   QYDGLPDAHFVRESKSTTNTKISGGWREHVVENEYDDSEAASTTFGLPMRTDDWGQSNV
FT                   SDNRCTTYGRAYNTDNYDSTGAQRWTVVQDQVKHYSVGCSSIADSNQDGYTSTLYDNAT
FT                   SIDANKPVDGNATEVRTYTKAGRYRSSWTGYDKAGRIVWSEDGKHNRSTITYSPANTWP
FT                   MNGITSTSPDPDGTATARGPLTFTEWTSRFWATPTTSKDANGNITKVTLDAAGRPVEVW
FT                   KPTETGSSPSMKFSYTIPTSTNSAGVPDSADGYPHVASHTLQSGSTYLVSHAYTDGLGR
FT                   ARETQTPLPSDVDPATKQIVPFRQVAVTRYDSAGQVTGASAVFRNQGTAGSGGPSSPQP
FT                   SDLPSYSDLVLDWAGRTVSSQIQVKGTPQKAGRVDTSYLGDYTSVTPVDSTATDTYTDV
FT                   YGQVSKVVEHTASSAYTTAYGYTAKGELAQITDPRGNNTLYTYDWAAQRKTTDDPDAGL
FT                   SSSEYNENGQVSQTTATTNDVQTVLTYGYDNLSRATSVRSGADELAAWVWDDPAATGGK
FT                   GQITSAVSRDASGNTYTTKTGKFDERGRPLNTTVTLPTTVNGLAGDYTTSVTYDAADHI
FT                   TSVSYPAAGKLAAEKVTTTYDDYGQPTRLTSSLGGTAYIDNTTYDAYGRLVERDYGAEF
FT                   GGNGIQAQRQYGYDDSNGTRWLRSIATTTTINDLVSEAQKDTYLYDNTGKLTELREQAS
FT                   GQTAQSQCLRYDDQSRLTLAYTHTTAGNCADTTKTTSDFKGTSPYQTGYTYDRLGNLQS
FT                   VTDTNSAGAATTRDYLYPGYDDAGTWTTANADQPHGVRKINKVSAGTTTAAGTYTYYAD
FT                   GAMKQRVEGSTTTDYTWSRLGRLATVKTTKTSGSDLTRYTYDASGNLLVRTTPQETVAS
FT                   IGGTELRTTDGISATATRYYSFGATTVAMRTTDGNNTVNGKITYLMGDTQASTQIAVDA
FT                   ATGTATRRRYTPFGDERSGSLPTGTNHGFLGKTEDTNTGLSLLGARAYDPSLGRFLSPD
FT                   PLSTPYDPQNLSAYSYSGNDPINYSDPSGLIKLNSDGTQCSDGWQKCGPGTVGGGGDTP
FT                   TPAPTVQDQLVDLLPREENGWDADRLAQVWVHYGQTTQGGGYWDAPVGDGDRTGMACFG
FT                   RTACSEAFRVWKETHDFAKAKRVAATFCVENPKRCGADNGAYDSMKEASEAVPILLAGE
FT                   MGAAFSKVLKARGCSFKPTTRVLMKDGKTKPLGKIKPGDLVEAADPTSGHHREVREVTA
FT                   VHLNHDDDLVDLSIRGLDGRIQTLHTTARHRIWDDTAQVWEQAGRLITGHKVNTSGNQH
FT                   ATITSVLAQRGAADMYDLTVEGLHTYYVLAGETPVLVHNGSCWSSTNRKTSVKNAFGHW
FT                   KKHKSEFPNLNNAKEYVEAGTDFLRSTDPSVLTRTRANGDVIRFNPATDEFGVMDPSGV
FT                   PRTYFKPDPASHGYPTNLDYFNAQ"
     gtggctgctc ggcgtacgcg ttttctttcg gctggtgttg caggtgcagt gctggcgggt        60
     ctgctgtcga cgatgtcggt ggttgcaccg cagcaggcgt ttgcgacggc ggatgatccg       120
     acgccggtcg tgccgtcgca gtcgctgggg tccgttcccg cgcagcaggc ggaagaagtg       180
     ggtaaggcgc tccctgaccc gaagtggccc aacgctgccg aggcgacggt ggatctgtcg       240
     caggcagcgc ccggggatcc cggcacggtg accccgtcgc cgactaccac gggcagcgag       300
     aacagcactc aggtcggtga cgtcgtggac gttgctccgg ctccggatcc tgtgggcgcc       360
     accacgcagc tgtcggcgca acggcgtgcg gacggcgacg tctcaccgag ccctagcgcc       420
     tccagtagca ctgacgcaag cacctcgcca agccccgagg ccagcactag ttcctcacca       480
     cagcccccgg attctgtcac gtccgagccc gaccaggacc cggtgtcgcc ggatcaggtc       540
     caggtgcgag tactggacca tcagaccgta gagccggcgg gcgggatcgg tcttgggttg       600
     caggtgaacc ggaccgacgg ggtgaatgcc ccggggcagg tgcaagtcga tgtcgactac       660
     tcgggtttcc agtacgccta cggtgccgac ttcgcctcgc gtcttcgact ggtgaaactg       720
     cccgcgtgtg cgttgcagac cccggaggcg gagggctgca ccgatcgcga gttcgtgccg       780
     gtggataacg acaccgcgac agggaccctg actgccacgg tcaccgcggc cgcggacacg       840
     gaagtctcgg gtgcctcaac ccagctgatg cgcgaggcca gtgcgagcgg cgcgagtgtg       900
     tacacgctag cgtcggggtc atcgtcggat gccggtgact accgggcgtc gacgctgtcg       960
     ccgaccggtt cgtgggaggt gtccactggt tcaggtgcgt tcacctacaa cgtgcccatc      1020
     cagctgccga agccgccgat gggctcagcg ccgtcgctgt cactgtcgta caactcgcag      1080
     tcggtcgacg gccgtacctc cgcctcgaac aaccaggcat cctgggcggg catgggctgg      1140
     gacctcaacg ttggctacat cgagcgccgc taccgcaact gctccgagga cggcctgccg      1200
     accatcggcg acatgtgctg ggactctccg aactcggcca aggaaccgtc cggcgcggtc      1260
     tacgtcatca acctcaacgg tgtcacctcg gagctgatcc aggacaacac cggtagcggc      1320
     gcctaccacc tcaagaatga tccgggctgg cgcgtgcagc gcctgttcga tgggtatggc      1380
     gcgggccggg acggcgagta ctgggtgatc tccacccagg acgggcagcg ctactacttc      1440
     ggctggggcc gctctgagcg caccggtacc gctaccgcct cggtcttcac tgagccggtg      1500
     gtcggcaatg acacgggcga accgtgccat gaccagttcc cggagccgtg cactcaggcc      1560
     tggcgctgga gcctggatag ggcggtggat gccaacgagg tcgagaccat gtacttctat      1620
     gacaaggagt acaaccacta ccgttccgtc gccaactccg acaaggcccg cgagtacgtc      1680
     tccagtggct atgtgaagga gatccagtac ggctggtcct cgcagatccc cgacggcaag      1740
     ctgccggcga aggtcgaact cagccacgtc aaccggtgca tcgagcgcgt acaggaaaat      1800
     gatcccctcc gcgacgaacc cgccacctgc cccaccttcg acgacaaacc gacctcgtat      1860
     ccggacgtgc cggtcgacct gatgtgtgac ggcacatcgg ccgactacaa ctgcgcgggc      1920
     aagacgtact acccgacgtt cttctccacg gacatgctgt gggacgtcaa gacgtacgtc      1980
     agcgaccagg acggcacggg ctgggacctg gtcgagcagt accagaacaa atacggcatg      2040
     cccaaccccg acggcacgat cggcaagacc ctctggctcg actacatcca gcgcaagacc      2100
     tacggcgacg gcgacgacat cgtcttgccg gtcatcaact tcaaccggac cgacctcgac      2160
     aacaaggtcg gctccgcaga actgaacttc ccccgcatcc aggagatcca cggcgacctc      2220
     ggcgccacca ctaaggtctc ctacggcttc gccaacgcct gcgacatcga ccacctgccg      2280
     acccaggcct ccaacacaca ggactgctac tggcagaagt ggaccccgga aggggagacg      2340
     gagtcgaaaa ccggctggtt caagaaattc ctggtgacca aggtcgaagt cgacccgacc      2400
     gtcacgacca accaggacgg cgcgccagtg atgaccacct cgtacaccta cgagggcggg      2460
     gcaggctggc gcttcaccgg tgatccgctg gtcaaggacg aggacgagtc ctggtccgac      2520
     tggcgcggct accaggagac gcaggtcacc accggcgcgg acactgggca gaagaccaag      2580
     aagtactggc tctaccgagg cctggacgga gaccgtacct ccaagacgga cacgtcggcg      2640
     acgaagacag tcacggtcaa tgatggtgac ggaaacaact acgccgacca cgcctggctg      2700
     gccggccaca ccctctcgac atcgctgcgc gatgacactg acatctcgca cgagcgcacc      2760
     taccacacgt actggagcca caacaccgcc cagtacgacg gcctgcccga cgcccacttc      2820
     gtgcgcgaat ccaagtccac caccaacacc aagatcagcg gcggctggcg cgagcacgtc      2880
     gtagagaacg agtacgacga cagcgaggca gcttccacca cgttcggcct gcccatgcgc      2940
     accgacgact ggggccagag caatgtctcc gacaaccgtt gcaccaccta cgggcgtgcc      3000
     tacaacactg acaattacga ctccaccggc gcccagcgct ggaccgtagt gcaagaccag      3060
     gtcaagcact actccgtggg ctgctccagc atcgccgaca gcaaccagga cggctacacc      3120
     tccaccctct acgacaacgc caccagcatc gacgccaaca agccggtcga cggcaacgcg      3180
     accgaggtcc gcacgtacac gaaggcgggc agataccgct ccagctggac cggctacgac      3240
     aaggcgggcc gcatcgtctg gagcgaggac ggcaaacaca accgcagcac catcacctac      3300
     agcccagcca acacatggcc gatgaatggc atcacctcca ccagcccgga cccggatggc      3360
     accgcgacgg cccgcggccc cctcaccttc accgagtgga cgtcccggtt ctgggccacg      3420
     ccgaccacca gcaaagacgc caacggcaac atcaccaaag tcacactcga cgcagccgga      3480
     cgccccgtag aggtgtggaa gccgacggag accggcagct caccgtcgat gaagttcagc      3540
     tacaccatcc ccacctccac caacagcgcc ggagtcccgg actcggccga cggctacccc      3600
     cacgtagcct cacacaccct gcagtccgga agtacctatc tggtctccca tgcctacacc      3660
     gacggtctgg gccgggcccg ggaaacgcag acgcctctgc catccgacgt ggaccctgcg      3720
     accaaacaga tcgtgccgtt ccgacaggtc gccgtcaccc gctacgactc ggccggacaa      3780
     gtcaccggcg cctccgcggt cttccgtaac cagggaacgg ctggctccgg cggcccctca      3840
     agcccgcagc cctccgacct gccctcctac agcgacctgg tcctggactg ggccggccgc      3900
     accgtgtcct cgcagatcca ggtcaagggc acaccccaaa aggcagggcg ggtcgacacc      3960
     tcctacctgg gcgactacac cagcgtgaca ccggtcgaca gcacagcgac cgacacctac      4020
     accgacgtgt acggacaggt gtccaaagtc gtcgagcaca ccgcgagctc ggcttacacc      4080
     accgcgtacg gctacaccgc caagggcgaa ctcgctcaga tcaccgatcc ccgcggcaac      4140
     aacaccctgt acacctacga ctgggccgca cagcgcaaga ccaccgacga cccggacgcc      4200
     ggcctctcca gcagcgagta caacgagaac ggccaagtca gccagaccac cgccaccacc      4260
     aacgacgtcc agaccgtcct cacctacggc tacgacaacc tgagccgcgc gacatctgtc      4320
     aggagcggcg ccgacgaact ggccgcctgg gtctgggacg accccgcagc caccggcggc      4380
     aagggacaga tcacctccgc ggtcagccgc gatgcgagcg gcaacaccta caccaccaag      4440
     accggcaagt tcgacgagcg cggccgacca ctgaacacca cggtcacgct gccgaccact      4500
     gtcaacggcc tcgcaggcga ctacaccaca tcggtcacct acgacgcagc cgaccacatc      4560
     acctcggttt cctaccccgc ggccggcaag ctcgccgcgg agaaggtgac caccacttac      4620
     gacgactacg ggcagcccac ccgtcttacc agcagcctgg gcggcacggc ctacatcgac      4680
     aacacgacct acgacgccta tggccgactg gtagaacgtg actacggggc cgagttcggc      4740
     ggcaacggca tccaggccca gcggcagtac ggctacgacg acagcaacgg cacccgctgg      4800
     ctgaggtcca tcgccacaac caccacgatc aacgacctgg tcagcgaggc acagaaggac      4860
     acctacctct acgacaacac cggcaagctc accgaactgc gcgaacaggc cagcggacag      4920
     actgcccagt cacagtgcct ccgttacgac gaccagtccc gcctcaccct cgcctacacc      4980
     cacaccactg ccggcaactg cgccgacacc acaaagacca cctctgactt caagggcacc      5040
     tccccctacc agaccggcta cacctacgac cgcctcggca atctccagtc ggtcaccgac      5100
     accaactcgg ccggtgcggc gaccacccgc gactacctct accccggata cgacgacgcc      5160
     ggtacttgga ccactgccaa cgccgaccag ccccacggtg tccgcaaaat caacaaagtc      5220
     agcgcaggta ccaccacggc agcgggtaca tacacgtatt acgccgacgg ggcgatgaag      5280
     cagcgcgtcg aaggcagtac gacaactgac tacacctgga gccggctcgg ccgactcgcc      5340
     acggtcaaaa ccaccaagac cagcggcagc gacctcaccc gctacaccta cgacgccagc      5400
     ggcaacctcc tcgtccgcac caccccgcag gaaaccgtcg cctccatcgg cggcacagaa      5460
     ctgcgcacca ccgacggcat cagcgccacc gcgacgcgct actacagctt cggcgcaaca      5520
     accgtcgcca tgcgcaccac cgacggcaac aacaccgtca acggcaagat cacctacctg      5580
     atgggagaca cgcaagcctc cacccagatc gccgtcgacg ccgccacggg caccgcaacc      5640
     cgccgcaggt acaccccctt cggtgacgaa cgcagtggca gcctgccgac cggcaccaac      5700
     cacggcttcc tcggcaaaac agaggacacc aacaccggcc tgtccctcct cggcgctcgc      5760
     gcctacgacc ccagcctcgg acgcttcctc agccccgacc ccctcagcac gccctacgac      5820
     ccgcagaacc tctctgccta cagctacagc ggcaacgatc ccatcaatta ctccgacccg      5880
     tccgggctga tcaagctgaa ttcggacggc acgcaatgca gcgacggatg gcagaagtgc      5940
     ggaccaggca ctgtcggagg cggtggggac acccccacac ccgctcccac ggtccaagac      6000
     cagcttgtcg atctgcttcc gcgagaagaa aacggctggg acgcagaccg cttggcccag      6060
     gtatgggtgc actacggcca aacgacacag ggcggcggct actgggatgc cccggtcggc      6120
     gacggagacc ggaccggcat ggcgtgtttc ggccgcaccg cctgctccga ggccttccgc      6180
     gtctggaagg agacccacga cttcgcaaaa gcgaagagag tcgcagccac cttctgcgta      6240
     gagaacccaa agcgctgcgg tgccgacaac ggcgcctatg actccatgaa ggaagcatcc      6300
     gaagcagtac ccattttgct cgctggcgaa atgggtgccg cattcagcaa ggtcctcaag      6360
     gcccgcggat gcagcttcaa accgaccacc cgcgtgttga tgaaggacgg gaagaccaaa      6420
     ccccttggca aaattaagcc tggggaccta gtcgaggccg cagacccaac atccggacac      6480
     catagagaag tcagggaagt caccgcggtt cacctcaacc acgacgacga ccttgttgat      6540
     ctgagcatcc gaggccttga cggacgaatc caaaccctgc acaccactgc gcgccaccgg      6600
     atctgggacg acacggcgca ggtttgggag caagccgggc ggctgatcac gggccacaag      6660
     gtcaacactt caggcaacca gcacgccaca atcacctctg tgcttgctca gcgcggtgca      6720
     gcagacatgt acgacctcac cgtcgaaggc cttcacacgt actatgtgct ggcgggcgag      6780
     actccggtcc tcgttcacaa cggcagctgt tggagctcca ccaacaggaa gacgtccgtc      6840
     aagaacgcct tcgggcactg gaagaagcac aagtcagaat tcccgaacct caataacgcg      6900
     aaagaatacg tggaggcggg taccgatttc ctgcgcagca ccgatccaag cgtactgacg      6960
     cgaacgcgag cgaacgggga tgtgattcgc ttcaatccag ccacggatga gttcggcgtc      7020
     atggatccat caggggtgcc gcgcacgtac ttcaagccag accctgcatc tcacgggtac      7080
     ccgacgaatc tggactactt caatgcccag tga                                   7113
//

If you have problems or comments...

PBIL Back to PBIL home page