(data stored in ACNUC7421 zone)

EMBL: BA000030.PE202

BA000030.PE202       Location/Qualifiers
FT   CDS_pept        complement(237840..238601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_202"
FT                   /old_locus_tag="SAV_202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_202"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67911"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RE1"
FT                   /protein_id="BAC67911.1"
FT                   /translation="MVGGQWRGVVERLAQQLGEAQAAGRRVKEAKATAARQSPSSTGLE
FT                   RAEYQRRLRAYVQTPEHKAAGHAIRVAVALMKAHDAALLRSAHTLLARRANGKRPPRRL
FT                   PRPLVLPGGYASQWWISSIDSTYAGIWRAIPSPGPELRLGSTNDPLVQEVAKQARLLQA
FT                   SHVGYRGRDDLYEAFHPDGTREGGEPVAPIRGLSQETSRRANLALGRGNGIRIQPSRME
FT                   EAGQMHTDYFAVWDRSRAYAAAVLALLRARA"
     atggtggggg gccagtggcg gggagtcgtc gaacggcttg cgcagcaact cggcgaagcc        60
     caggcggccg gccggcgtgt gaaagaggcg aaggcgaccg cggctcgcca gagcccgagc       120
     agcaccggcc ttgaacgcgc cgagtaccag cgccggctgc gcgcgtatgt acagaccccc       180
     gagcacaagg cggcgggcca cgccatcagg gtcgccgtgg ctctgatgaa ggcgcacgac       240
     gctgccctgc tgcgttcggc acacacactg cttgcccggc gcgccaacgg aaagcgccca       300
     ccccggcggt tgccgcggcc gcttgtactg cccggcggtt atgcgtctca gtggtggatc       360
     agcagcatcg actccacgta cgcgggcatc tggcgggcga tcccgtcccc cggaccggag       420
     ctccggctcg gcagcacgaa tgacccgctg gtgcaggagg tcgccaagca ggcacgtctg       480
     ctgcaggcca gccacgtggg ataccgaggg cgcgacgacc tgtacgaggc tttccacccc       540
     gacggcacgc gcgagggcgg cgagccggta gcgccgatcc gcggcctgag ccaggagacg       600
     agccgccgcg ccaacctcgc actcggccgc ggtaatggca tacgcatcca gccctcccgg       660
     atggaggagg ccggtcagat gcacaccgac tacttcgccg tctgggaccg atcccgcgcg       720
     tacgcggccg ccgtgctcgc cctgctgcgg gcccgcgcgt aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page