(data stored in ACNUC7421 zone)

EMBL: BA000030.PE208

BA000030.PE208       Location/Qualifiers
FT   CDS_pept        complement(242908..243411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_208"
FT                   /old_locus_tag="SAV_208"
FT                   /product="putative IstB-like ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_208"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67917"
FT                   /db_xref="GOA:Q82RD5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RD5"
FT                   /protein_id="BAC67917.1"
FT                   /translation="MIHTLAKCEWIKKSLPLCLIGDSGTGKSHLLIALGTEAAMAGYRV
FT                   KYVLATKLVNELVEAADEKQLTKTIARYGRVDLLCIDELGYMELDRRGAELLFQVLTER
FT                   EEKNSVAIASNESFSGWTKTFTDPRLCAAIVDRLTFGGNIIETGTDSYRLATTRARAEQ
FT                   QAVV"
     ttgatccaca ccctcgccaa gtgcgaatgg atcaagaaga gcctgccgct ctgcctcatc        60
     ggtgactccg gcaccggcaa gtcccacctg ctgatcgcac tcggcaccga agccgcgatg       120
     gccggctacc gggtcaagta cgttctcgcg accaagctcg tcaacgagct cgtcgaggcc       180
     gccgacgaga agcagctgac caagaccatc gcccgctacg gccgcgttga tcttttgtgc       240
     atcgacgagc tcggctacat ggagctcgac cggcggggcg ccgagctcct cttccaggtt       300
     ctgacggagc gggaggagaa gaacagcgtg gccatcgcct cgaacgagtc gttctctggc       360
     tggaccaaga ccttcaccga cccccgcctc tgcgcggcca tcgtcgaccg tctcaccttc       420
     ggcggcaaca tcatcgagac cggcacggac tcctatcgcc tcgccaccac ccgcgcccgc       480
     gccgagcagc aggccgtcgt ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page