(data stored in ACNUC7421 zone)

EMBL: BA000030.PE210

BA000030.PE210       Location/Qualifiers
FT   CDS_pept        complement(245081..246040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_210"
FT                   /old_locus_tag="SAV_210"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_210"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67919"
FT                   /db_xref="GOA:Q82RD3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RD3"
FT                   /protein_id="BAC67919.1"
FT                   /translation="MARPEKDIPAAAPMEVAELARELRALRRSSGLTYKDLSDKSHYSS
FT                   AALSTAASGKTVPKWEVVESFVRGCGFTGDLTTWQRLHKNALARAKTEEAAGKVKVRAA
FT                   EAETGEPDGADERTEVHHPRLLGGLRKPVPAPEAVVPAQPDGLLTLVQQFMDAHMQLDA
FT                   RLPEDPQRVSSLTVDHVHTALALCTTPQDVLSVMRELVADKGLTIGALERRSRKYYPIS
FT                   GATFAHVLNGDELPTTEWLNIFLRACGVDQERTLIWHYTVTRIKIANLRHRKTPPPLTV
FT                   TPVEPSISADYMRRLLVLTVGVMSVLGATVTAVIATIR"
     atggcgcgtc ctgagaagga catcccggca gccgcgccga tggaggtggc ggagctcgcc        60
     cgcgaactgc gggcgctccg ccgctccagt ggcctgacct acaaggacct gtccgacaag       120
     tctcactact cctccgctgc gctgtcgacc gcggcatccg ggaagacagt gcccaagtgg       180
     gaggtcgtgg agtcattcgt ccgcggctgc ggcttcaccg gcgacctcac tacctggcag       240
     cgcctgcaca agaacgccct ggcgcgcgcc aagactgagg aggccgcggg caaggtcaag       300
     gtgcgcgctg ccgaagccga aaccggtgag cctgacggcg ccgacgagcg gaccgaagtg       360
     catcaccccc gcctgctcgg tggcctgcgc aaacctgtcc cggccccgga agctgtcgtc       420
     cccgcgcagc cggacggtct gctgaccctc gtgcagcagt tcatggacgc ccacatgcaa       480
     ctggacgccc gtcttcccga ggatccccag cgggtcagca gtctcacggt cgaccacgtg       540
     cacactgcgc tggcgctgtg caccactccg caggacgtgc tgtccgtcat gcgcgagctg       600
     gtggcggaca agggactgac cataggggcg ctggaacgcc gcagtcgcaa gtactacccg       660
     atatccggcg cgaccttcgc ccacgtgctc aacggggatg aactgcccac caccgagtgg       720
     ctgaacatat tcctgcgggc gtgcggagtc gaccaggagc ggacgctgat ctggcactac       780
     acggtgactc gcatcaagat cgcgaatctg cggcaccgga agacgccgcc tccgctgact       840
     gtcactcccg tggagccctc gatcagcgcc gattacatga ggcggcttct ggtcctcacg       900
     gtgggtgtga tgagcgtgct gggggccacg gttacggcgg tcatcgcgac cattcggtga       960
//

If you have problems or comments...

PBIL Back to PBIL home page