(data stored in ACNUC7421 zone)

EMBL: BA000030.PE212

BA000030.PE212       Location/Qualifiers
FT   CDS_pept        complement(247471..248142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_212"
FT                   /old_locus_tag="SAV_212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_212"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67921"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RD1"
FT                   /protein_id="BAC67921.1"
FT                   /translation="MTAIDDLLADARIPTTRREGFDVGAALRRLAADAAAAAAKPNPDM
FT                   VRAAQAGQRLSVVCRWILNKPDAADHVDRLAQEPETPADDGHLDVDGALVFACLLYLTE
FT                   HRESAQFWWQLAAGAGHRAAAYCLHLHHLALGEVREARHWLHEVTDDVLDSEAPDSAFL
FT                   ATLEAVAMYVRRTGSSLAGAPTGGLEMEVDRLATAKADSCIIVQRPGRRLADLMHDFTR
FT                   R"
     gtgaccgcca tcgacgacct cctggccgac gcccgcatcc ccaccacgcg acgcgagggc        60
     ttcgatgtgg gtgccgccct gcgccgcctc gccgccgacg cggccgccgc cgcagccaag       120
     ccgaacccgg acatggtccg cgccgcccag gccggacagc ggctgtccgt ggtgtgccgt       180
     tggatcctca acaagcccga cgccgctgac cacgtcgacc gcctcgccca ggaacccgaa       240
     acccccgccg acgacggcca tctggacgtc gacggcgccc tcgtcttcgc gtgcctgctc       300
     tacctgaccg aacaccgcga gagcgcccag ttctggtggc agctcgccgc cggggccggc       360
     caccgcgccg ccgcatattg cctgcacctg caccaccttg ccctgggtga ggtgcgggag       420
     gcgcggcact ggctgcacga ggtcaccgac gacgtcctcg actcggaagc acccgacagc       480
     gccttcctcg ccactttgga ggccgtcgcg atgtacgtcc gcaggaccgg ctccagcctc       540
     gccggcgctc ccaccggggg actggagatg gaggtcgacc gcctggctac cgcgaaggcc       600
     gactcctgca tcatcgtcca gcgtcccggc aggcgcctcg ccgacctgat gcacgacttc       660
     acccggcgct ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page