(data stored in ACNUC7421 zone)

EMBL: BA000030.PE220

BA000030.PE220       Location/Qualifiers
FT   CDS_pept        256598..257401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_220"
FT                   /old_locus_tag="SAV_220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_220"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67929"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RC3"
FT                   /protein_id="BAC67929.1"
FT                   /translation="MSGGLMHTFTVTERDVTQAWVAACNKLDRKDNPDRTGLHTVVRIA
FT                   DPTSDDPVFRAELDRLRTARGLWPLETVASTLFPAALAARSADPDDLAERYRRMYPVIK
FT                   RYPGNHRGTYFGRLVFYPAASKTGIDQLSTVISRLRTQAAGTKIAAAYEIDIAAATDQE
FT                   EAGADLLVHTAGKDNSYIGFPCLSHISLQLDRDRRVHAAALYRSHFMFERAYGNYLGLG
FT                   RLLAYIAQQAELACGTLTVMAGHARLDGPVTQLRPLLTGTSRLAA"
     gtgtcaggag gactgatgca caccttcacc gtgaccgaac gcgacgtcac ccaggcctgg        60
     gtcgccgcct gcaacaagct ggaccgcaag gacaacccgg accggaccgg cctgcacacg       120
     gtggtgcgca tcgccgaccc gacgagcgac gacccggtgt tccgcgccga actcgaccgg       180
     ctgcgcaccg ctcgcgggct ctggccgttg gagaccgtgg ccagcaccct gtttcccgcg       240
     gccctggcgg cacggagcgc cgacccggat gacctcgccg agcgctaccg acggatgtat       300
     ccagtcatca agcggtaccc gggcaaccac cgcggcacgt acttcggccg cctggtgttc       360
     taccctgcgg cgtcgaagac cggcatcgac cagctcagca ccgtcatcag ccgactgcgg       420
     acacaggccg cgggcaccaa gatagccgcc gcgtacgaga tcgacatagc cgcagccacg       480
     gaccaggagg aggctggcgc ggatctgctg gtccacactg ccgggaagga caacagctac       540
     atcggcttcc cctgcctgag ccacatctcc ctccagctgg accgcgaccg gcgggtgcac       600
     gccgcggccc tgtaccgcag ccacttcatg ttcgagcgcg cctacggtaa ctacctcggc       660
     ctgggccgcc tgctggccta catcgcccag caggccgaac tggcctgcgg aaccctgacc       720
     gtaatggccg gccacgcccg gctggacggc cccgtcacac agctgcgccc gctgctgacc       780
     ggcaccagcc gcctcgcggc ataa                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page