(data stored in ACNUC7421 zone)

EMBL: BA000030.PE23

BA000030.PE23        Location/Qualifiers
FT   CDS_pept        complement(30107..30394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_23"
FT                   /old_locus_tag="SAV_23"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_23"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67732"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RW9"
FT                   /protein_id="BAC67732.1"
FT                   /translation="MGLGDVTNSLLGGAENLYDAGKKKLGEGVDWATDKVGEGLDKVGA
FT                   HDWADSVEDWGDEIASDLGPPRVSSSSARPRSPTNSSTAIRTRSARVPST"
     atgggactcg gcgatgtcac caactcgctt ctgggtggcg cggagaacct ctacgacgcg        60
     ggcaagaaga agctcggcga gggcgtcgac tgggccacgg acaaggtggg cgagggcctg       120
     gacaaggtcg gtgcgcacga ctgggccgac agtgtggagg actggggcga cgaaatcgcc       180
     tccgacctgg ggccaccccg ggtgagcagc agctcggcca gaccgaggag cccgacgaac       240
     tcgtctacgg ccatccggac aagatccgcg agagtgccaa gcacctga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page