(data stored in ACNUC7421 zone)

EMBL: BA000030.PE236

BA000030.PE236       Location/Qualifiers
FT   CDS_pept        275872..276393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_236"
FT                   /old_locus_tag="SAV_236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_236"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67945"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RA7"
FT                   /protein_id="BAC67945.1"
FT                   /translation="MRGSRHEHHATPAWHQTGRPRRHRHRHRRRNRSPHGCSPSNASSR
FT                   TRQAATQHQAVADRTGDATIGPDPEVRPPERPQANQSRGGPGLLLALALPILMRAALFA
FT                   LDAFEDRLFPPPAPADDESLAADTRSLALTTSPPRPARPGSDTARARHCAYDAVGESPA
FT                   GQWHESRLRS"
     gtgcgaggct cccgccatga gcaccacgcg acgccggctt ggcaccagac cggacgcccc        60
     cgccgccacc gccaccgcca ccgccggcgg aaccgaagtc cccacggctg ctccccgtcg       120
     aacgcatcga gccggacccg gcaggcggcg acccagcacc aggccgtggc cgaccggaca       180
     ggcgatgcca ccattgggcc ggaccctgaa gtccggcccc ctgagcggcc ccaggccaac       240
     cagtcaaggg gaggtcccgg gctcctgctc gcgctcgcac tgccgatcct gatgagggcg       300
     gcgctctttg ccctggatgc cttcgaagac cgtctcttcc cgccccccgc gcctgcggac       360
     gacgaaagcc ttgccgccga cacaagatcg ctcgccctga cgacgtctcc cccgcgccca       420
     gcgcggccag gctcggacac ggcgagggcc cggcactgcg cctatgacgc tgttggcgaa       480
     tcgcctgcag gccagtggca cgagtctcgt ctcaggagct ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page