(data stored in ACNUC7421 zone)

EMBL: BA000030.PE239

BA000030.PE239       Location/Qualifiers
FT   CDS_pept        complement(278470..279057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_239"
FT                   /old_locus_tag="SAV_239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_239"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67948"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RA4"
FT                   /protein_id="BAC67948.1"
FT                   /translation="MQGHRSNYVRPHCYCAACMGLGLRIGAFGPAVDEEGNTVPGSRAV
FT                   YPWSALPAVIGGDVDRDERPFAWFTHFLEAAGPVVVDEGDGENLWPRGIQHDDALFCET
FT                   GVTGEFGLADGVAATQFQPGAGRTALHLGRHPVEQLLPSWDHRVLRFPGQIGAVEVEDV
FT                   VVLKDHFCCSSVPSHTLPGDGHAQEVRTGDRA"
     gtgcaggggc accggagcaa ctacgtccgg ccgcactgct actgcgccgc ctgcatgggc        60
     cttggtctcc gcatcggcgc cttcgggcct gccgtcgacg aagagggcaa caccgttccc       120
     ggatcccggg ccgtctaccc ctggtcggcg ctgcccgcgg tcatcggcgg cgatgtcgat       180
     cgcgacgagc ggcccttcgc ctggttcacg cacttccttg aggcggccgg gcccgtcgtg       240
     gtcgacgagg gggacggcga gaatctgtgg ccgcgcggga ttcagcacga cgacgccttg       300
     ttctgcgaaa ccggcgtcac cggagagttc ggcctcgccg acggcgtcgc ggcgacccag       360
     ttccagccgg gcgcggggcg gaccgccctc cacctcggcc ggcaccccgt cgaacagctc       420
     ctgcccagct gggatcaccg cgtcttgcgc ttcccagggc agatcggagc tgtcgaagta       480
     gaagatgtcg tagtcctcaa ggaccacttc tgctgctcct ccgtgccctc gcacactctc       540
     cccggtgatg ggcacgcgca agaggtccga acgggtgaca gggcgtag                    588
//

If you have problems or comments...

PBIL Back to PBIL home page