(data stored in ACNUC7421 zone)

EMBL: BA000030.PE24

BA000030.PE24        Location/Qualifiers
FT   CDS_pept        complement(30394..31323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_24"
FT                   /old_locus_tag="SAV_24"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_24"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67733"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RW8"
FT                   /protein_id="BAC67733.1"
FT                   /translation="MASVSSWPSRTSRRWPVTRWHAVRRRVSGRTRRSSARDCWMWRCP
FT                   RQGCPGGWRWTARTAKRAWSSRRCAASCRTRQHSTSTPTGTRGRGMSGDGKDLKTEGLA
FT                   LIAKGLTEALGELKELGMVGEAGAGRGFGDIALSGLELGHEGLTGEFTSFCERWEWGVR
FT                   SLINEGNGFALKTGLSAGTYYETDKYIEGTFKVVTNAAIGNPYASEENVEKMGWGDIAT
FT                   SGVYGGNVDYSKESFDQAMANSGQAWKDAGRDVMTSHTIGPVPGVNPEELHGAFGVSDD
FT                   EYNQYLDDTFGPSPEARAKAAEQQGGEG"
     gtggcatccg tttcatcctg gccttctcgg acgagcaggc gttggcccgt tacgcggtgg        60
     cacgcggtga ggcggcgcgt gagtggacgt accagacgat cctcggcgcg cgactgctgg       120
     atgtggcggt gcccgcggca ggggtgccct ggggggtggc gctggactgc gcggacggcg       180
     aagagggcat ggtcttcccg ccggtgcgcg gcatcgtgcc ggacgaggca gcactcgaca       240
     tcgacgccga cagggacgcg ggggcggggc atgagcggtg acggcaagga cctgaagacc       300
     gaggggctgg cgctgatcgc caagggtctg accgaggcgc tgggcgagtt gaaggagctg       360
     ggcatggtcg gcgaggccgg agccgggcgc ggcttcggcg acatcgccct gtccgggctt       420
     gagctcggcc acgagggcct tacgggtgag ttcacgtcgt tctgcgagcg ctgggagtgg       480
     ggcgtgcggt cgctgatcaa cgagggcaac ggcttcgcgc tgaagacggg cctgtcggcg       540
     ggcacatact acgaaaccga caagtacatc gagggcacct tcaaggtcgt caccaacgcg       600
     gccatcggca atccgtacgc ctcagaggag aacgttgaga agatgggctg gggcgacatc       660
     gccacgtccg gggtgtacgg cggcaacgtg gactacagca aggagtcctt cgatcaggcg       720
     atggccaaca gcgggcaggc ctggaaggac gcgggccggg acgtgatgac ctcgcacacg       780
     atcggtccgg tgccgggcgt gaacccggag gaactgcacg gcgcgttcgg agtgtccgac       840
     gacgagtaca accagtacct ggacgacacc ttcgggccct ctcccgaggc tcgcgccaag       900
     gcggccgagc agcagggcgg tgagggctga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page